TkA08G181970 | RubberDandelionOmics

Gene overview

TkA08G181970

Reference: TK1151 Chr: Chr08 Coordinates: 47575759-47576400 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

642 bp · TkA08G181970|TK1151|cDNA

ATGGCGAAAGTTGATGAGGTAAATAAGAGGATGGATGGCCAGGATGCAACCTTGAAATCGATTCAGTCAAATCTTGTGGAATTGACATCTGCCGTGAAAGCCTTGGTCACAACACAGGACAAATCGAAGGTCAAGGGTTATGAATCAGATGCACCTCACAATATTGATGTGGAAGAATCTGATGGGCAACTACATGAAGATGGTGAGTTAGGAAAAAACGGGTATATAACACAACTTTCCAAAACAGAATATGAAGAAAA...

CDS

Download CDS FASTA

642 bp · TkA08G181970|TK1151|CDS

ATGGCGAAAGTTGATGAGGTAAATAAGAGGATGGATGGCCAGGATGCAACCTTGAAATCGATTCAGTCAAATCTTGTGGAATTGACATCTGCCGTGAAAGCCTTGGTCACAACACAGGACAAATCGAAGGTCAAGGGTTATGAATCAGATGCACCTCACAATATTGATGTGGAAGAATCTGATGGGCAACTACATGAAGATGGTGAGTTAGGAAAAAACGGGTATATAACACAACTTTCCAAAACAGAATATGAAGAAAA...

Protein

Download Protein FASTA

213 aa · TkA08G181970|TK1151|PROTEIN

MAKVDEVNKRMDGQDATLKSIQSNLVELTSAVKALVTTQDKSKVKGYESDAPHNIDVEESDGQLHEDGELGKNGYITQLSKTEYEEKRMKNECLYCRQKYTQGHKCRLSKLLMLICPDAEDGKIDNGDSTVMEESDHGDKMSLFTPNPKPDEDIDLKEESLFPPVNDFASGVENMMQMPTSNPFVFGISDSWRKQTNVGHRSDWKRKAKVHLV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G181970`
TK1151 ID	TkA08G181970
OH-1004 ID	LXL04_032502
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.400
Protein coverage (%)	TK1151 98.592 / OH-1004 36.256 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G181970`
Location	Chr08:47575759-47576400 (-)
Description	Similar to abh1: Alpha-ketoglutarate-dependent dioxygenase abh1 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032502` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006307 DNA alkylation repair Biological Process GO:0009845 seed germination Biological Process GO:0010029 regulation of seed germination Biological Process GO:0035513 oxidative RNA demethylation Biological Process GO:0042245 RNA repair Biological Process GO:0070989 oxidative demethylation Biological Process GO:0072702 response to methyl methanesulfonate Biological Process GO:1990983 regulation of translational initiation by tRNA modification Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	ath:AT3G14140 ath:AT3G14160 ath:AT5G01780 ecj:JW2200 eco:b2212 ecoc:C3026_12360 spo:2539935 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.639

Rank 1 · TkA08G181970 · TK1151

Cytoplasm0.424

Rank 2 · TkA08G181970 · TK1151

Mitochondrion0.046

Rank 3 · TkA08G181970 · TK1151

Cell membrane0.030

Rank 4 · TkA08G181970 · TK1151

Endoplasmic reticulum0.025

Rank 5 · TkA08G181970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10779XhlA3-38 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G181970	`PF10779`	XhlA	3	38	0.17	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card