TkA08G177990 | RubberDandelionOmics

Gene overview

TkA08G177990

Reference: TK1151 Chr: Chr08 Coordinates: 46573241-46574233 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · TkA08G177990|TK1151|cDNA

ATGGACTTCACCTCCGATCCTTGTTCGCCGCCGCATGTAACTCATTTCCTCTGTGGATTGTCCTGCTCCGGCAATCGGGTTACTCAGCTTACCCTTGACCCCGCCGGTTACGTCGGAACTCTGTCGCCGCTTGTATCTCAGCTTACCCAGCTCATCACCATCGATCTCTCTGATAACAAATTCTCCGGGCCTATTCCGAATTCTCTGTTCTTTCTACCTAACCTGCAGACACTTATGCTTGGGTCGAATTCGTTCTCTGG...

CDS

Download CDS FASTA

993 bp · TkA08G177990|TK1151|CDS

ATGGACTTCACCTCCGATCCTTGTTCGCCGCCGCATGTAACTCATTTCCTCTGTGGATTGTCCTGCTCCGGCAATCGGGTTACTCAGCTTACCCTTGACCCCGCCGGTTACGTCGGAACTCTGTCGCCGCTTGTATCTCAGCTTACCCAGCTCATCACCATCGATCTCTCTGATAACAAATTCTCCGGGCCTATTCCGAATTCTCTGTTCTTTCTACCTAACCTGCAGACACTTATGCTTGGGTCGAATTCGTTCTCTGG...

Protein

Download Protein FASTA

330 aa · TkA08G177990|TK1151|PROTEIN

MDFTSDPCSPPHVTHFLCGLSCSGNRVTQLTLDPAGYVGTLSPLVSQLTQLITIDLSDNKFSGPIPNSLFFLPNLQTLMLGSNSFSGVIPPSISNLKSLQTLDISRNSLSGSLPKTLTSLTALTRLDLSFNKLTGPIPGLPKNIVQLALKGNSLYGYLLKQSFLGLAQLETVELSENSLTGTIPGWFFLIPSLQQVNLAKNSFTGVEIFKPIESNLIAVDLGFNRITGYPPANFSAYPFLSSLTLSYNKLRGRIPWEYGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G177990`
TK1151 ID	TkA08G177990
OH-1004 ID	LXL04_017382
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.697 / OH-1004 86.352 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G177990`
Location	Chr08:46573241-46574233 (-)
Description	Similar to DRT100: DNA damage-repair/toleration protein DRT100
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017382` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0007165 signal transduction Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0090696 post-embryonic plant organ development Biological Process GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0004672 protein kinase activity Molecular Function GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	ath:AT3G12610 dosa:Os04g0576900 osa:4336741 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.479

Rank 1 · TkA08G177990 · TK1151

Cell membrane0.214

Rank 2 · TkA08G177990 · TK1151

Endoplasmic reticulum0.128

Rank 3 · TkA08G177990 · TK1151

Cytoplasm0.073

Rank 4 · TkA08G177990 · TK1151

Nucleus0.039

Rank 5 · TkA08G177990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00560LRR_120-30 aa

PF12799LRR_420-62 aa

PF14580LRR_926-132 aa

PF25019LRR_R13L1-DRL2135-81 aa

PF23598LRR_1440-198 aa

PF24048LRR_NXF1-541-61 aa

PF25013LRR_Zer-144-135 aa

PF23286LRR_1344-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G177990	`PF00560`	LRR_1	20	30	2.6e-26	86.7
TkA08G177990	`PF12799`	LRR_4	20	62	7.5e-20	71.2
TkA08G177990	`PF14580`	LRR_9	26	132	6.6e-05	23.3
TkA08G177990	`PF25019`	LRR_R13L1-DRL21	35	81	0.15	12.7
TkA08G177990	`PF23598`	LRR_14	40	198	8.8e-08	32.0
TkA08G177990	`PF24048`	LRR_NXF1-5	41	61	0.12	12.7
TkA08G177990	`PF25013`	LRR_Zer-1	44	135	0.00018	22.4
TkA08G177990	`PF23286`	LRR_13	44	110	0.17	12.3
TkA08G177990	`PF13855`	LRR_8	47	84	8.6e-29	99.8
TkA08G177990	`PF00560`	LRR_1	51	70	2.6e-26	86.7
TkA08G177990	`PF13516`	LRR_6	51	62	2.7e-06	27.7
TkA08G177990	`PF24758`	LRR_At5g56370	59	123	0.0097	16.3
TkA08G177990	`PF24141`	LRR_ComC	61	138	0.026	14.9
TkA08G177990	`PF13855`	LRR_8	73	133	8.6e-29	99.8
TkA08G177990	`PF12799`	LRR_4	73	110	7.5e-20	71.2
TkA08G177990	`PF13516`	LRR_6	73	85	2.7e-06	27.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card