TkA08G175020 | RubberDandelionOmics

Gene overview

TkA08G175020

Reference: TK1151 Chr: Chr08 Coordinates: 45790431-45792454 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1258 bp · TkA08G175020|TK1151|cDNA

CTACATTCCATCATAAAAGTGATTCACAAACTCTTTTAATGATGAACACTTTCTCACAAGTCTACAAGGATGACCCTATCACCTCTCACCATATTATCCCTCTTGACTTTGACTCAACGTATACGGTCCCAGAATCCCATCTATGGTCTCAGTCCGATGAGTCACATCAAAAGTATCAAACCGATGCCCCTCAAGATTCATTGATTCCGGTTATAGACCTCTGTGATACCAATGCAATGGATCTCATAGGTCAAGCATGT...

CDS

Download CDS FASTA

1041 bp · TkA08G175020|TK1151|CDS

ATGATGAACACTTTCTCACAAGTCTACAAGGATGACCCTATCACCTCTCACCATATTATCCCTCTTGACTTTGACTCAACGTATACGGTCCCAGAATCCCATCTATGGTCTCAGTCCGATGAGTCACATCAAAAGTATCAAACCGATGCCCCTCAAGATTCATTGATTCCGGTTATAGACCTCTGTGATACCAATGCAATGGATCTCATAGGTCAAGCATGTGAAACTTGGGGCGTGTTTCAAGTCATTAACCATGGAGT...

Protein

Download Protein FASTA

346 aa · TkA08G175020|TK1151|PROTEIN

MMNTFSQVYKDDPITSHHIIPLDFDSTYTVPESHLWSQSDESHQKYQTDAPQDSLIPVIDLCDTNAMDLIGQACETWGVFQVINHGVPLDLVKRVDYEARRFFAMTTHEKRKVLRSPSGSTGYGVPKISPFFAKCMWHEGFTIMGSCVDDAKVLWPHDYQRFCDTMDAYQSQMKLLTRKLLLLILQRLDVTHEEMNWATSTHGSHDALQLNSYPSCPNPSRTLGLVPHTDSLLLTVLNQNGVTGLEILVEGLGWIPVKPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G175020`
TK1151 ID	TkA08G175020
OH-1004 ID	LXL04_032432
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G175020

Location Chr08:45790431-45792454 (+)

Description Similar to LE: Gibberellin 3-beta-dioxygenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21690`	Converts the inactive gibberellin (GA) precursors GA9 and GA20 in the bioactives gibberellins GA4 and GA1.	Distinct and overlapping roles of two gibberellin 3-oxidases in Arabidopsis development.2006 · DOI: 10.1111/j.1365-313x.2005.02642.x
`At1g15550`	Converts the inactive gibberellin (GA) precursors GA9 and GA20 into the bioactives gibberellins GA4 and GA1, respectively.	Distinct and overlapping roles of two gibberellin 3-oxidases in Arabidopsis development.2006 · DOI: 10.1111/j.1365-313x.2005.02642.x
`At1g80330`	Converts the inactive gibberellin (GA) precursors GA9 and GA20 in the bioactives gibberellins GA4 and GA1.	Purification and kinetic studies of recombinant gibberellin dioxygenases.2005 · DOI: 10.1186/1471-2229-5-19 Distinct and overlapping roles of two gibberellin 3-oxidases in Arabidopsis development.2006 · DOI: 10.1111/j.1365-313x.2005.02642.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032432 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0010114 response to red light Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016707 gibberellin 3-beta-dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G15550

ath:AT1G80330

ath:AT1G80340

ath:AT4G21690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.695

Rank 1 · TkA08G175020 · TK1151

Nucleus0.398

Rank 2 · TkA08G175020 · TK1151

Plastid0.072

Rank 3 · TkA08G175020 · TK1151

Peroxisome0.068

Rank 4 · TkA08G175020 · TK1151

Mitochondrion0.062

Rank 5 · TkA08G175020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N56-148 aa

PF031712OG-FeII_Oxy206-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G175020	`PF14226`	DIOX_N	56	148	7.6e-19	69.2
TkA08G175020	`PF03171`	2OG-FeII_Oxy	206	304	4e-29	101.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVS8`	Arabidopsis thaliana	sp\|Q9SVS8\|G3OX3_ARATH Gibberellin 3-beta-dioxygenase 3	43.800%	Swiss-Prot	Medium
`Q39103`	Arabidopsis thaliana	sp\|Q39103\|G3OX1_ARATH Gibberellin 3-beta-dioxygenase 1	42.200%	Swiss-Prot	Medium
`Q9C971`	Arabidopsis thaliana	sp\|Q9C971\|G3OX4_ARATH Gibberellin 3-beta-dioxygenase 4	41.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card