TkA08G173810 | RubberDandelionOmics

Gene overview

TkA08G173810

Reference: TK1151 Chr: Chr08 Coordinates: 45430635-45432231 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1223 bp · TkA08G173810|TK1151|cDNA

CTTGAATGAGCTGTGGAAATGGGAAGAACACCATGTTGTGAAAAAATAGGGTTGAGAAGAGGAAGATGGACAGCCGAAGAAGATGAAATCTTGACTAAATACATTCAAGCCAATGGTCATGGTTCTTGGAGGTCAATACCTAAGAAAGCAGGGTTATTGAGATGTGGGAAAAGTTGTAGGCTGCGATGGACCAATTACTTAAGAGAGGACATAAGACGAGGCTATTATTCTCGAGAAGAAGAAGAACTAATCATCAAGTT...

CDS

Download CDS FASTA

834 bp · TkA08G173810|TK1151|CDS

ATGGGAAGAACACCATGTTGTGAAAAAATAGGGTTGAGAAGAGGAAGATGGACAGCCGAAGAAGATGAAATCTTGACTAAATACATTCAAGCCAATGGTCATGGTTCTTGGAGGTCAATACCTAAGAAAGCAGGGTTATTGAGATGTGGGAAAAGTTGTAGGCTGCGATGGACCAATTACTTAAGAGAGGACATAAGACGAGGCTATTATTCTCGAGAAGAAGAAGAACTAATCATCAAGTTACATACATCCTTGGGGAA...

Protein

Download Protein FASTA

277 aa · TkA08G173810|TK1151|PROTEIN

MGRTPCCEKIGLRRGRWTAEEDEILTKYIQANGHGSWRSIPKKAGLLRCGKSCRLRWTNYLREDIRRGYYSREEEELIIKLHTSLGNRWSAIASHLPGRTDNDIKNYWNSHLSRQTYAFFPIKRDSTQTLINMDNMVSHAKQRLGRVSRHMAKKYNYHSLVNNLTMPILGKSDDKNLGKDTTCVNGNTKEGQMSSNEIKMKEIDESWFKDDEPMDMSFLIDGDLADSYEILRVCDEDHNEKRSSGLDFNNSMLNACDVDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G173810`
TK1151 ID	TkA08G173810
OH-1004 ID	LXL04_005380
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.400
Protein coverage (%)	TK1151 100.000 / OH-1004 89.251 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G173810

Location Chr08:45430635-45432231 (-)

Description Similar to MYB12: Transcription factor MYB12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49330`	Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis.	Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling.2007 · DOI: 10.1111/j.1365-313x.2007.03078.x The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation.2010 · DOI: 10.1111/j.1365-3040.2009.02061.x Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation.2010 · DOI: 10.1111/j.1469-8137.2010.03421.x
`At2g47460`	Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis.	The Arabidopsis transcription factor MYB12 is a flavonol-specific regulator of phenylpropanoid biosynthesis.2005 · DOI: 10.1104/pp.104.058032 Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling.2007 · DOI: 10.1111/j.1365-313x.2007.03078.x The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation.2010 · DOI: 10.1111/j.1365-3040.2009.02061.x Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation.2010 · DOI: 10.1111/j.1469-8137.2010.03421.x
`At3g62610`	Modulates overall growth by reducing the proliferation activity of meristematic cells and delaying development.	Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling.2007 · DOI: 10.1111/j.1365-313x.2007.03078.x The AtMYB11 gene from Arabidopsis is expressed in meristematic cells and modulates growth in planta and organogenesis in vitro.2008 · DOI: 10.1093/jxb/ern027 The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation.2010 · DOI: 10.1111/j.1365-3040.2009.02061.x Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation.2010 · DOI: 10.1111/j.1469-8137.2010.03421.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005380 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006950 response to stress Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0010224 response to UV-B Biological Process

GO:0043477 pigment biosynthetic process involved in pigment accumulation Biological Process

GO:0043480 pigment accumulation in tissues Biological Process

KEGG gene cross-reference

ath:AT2G47460

ath:AT3G62610

ath:AT5G49330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.924

Rank 1 · TkA08G173810 · TK1151

Cytoplasm0.169

Rank 2 · TkA08G173810 · TK1151

Mitochondrion0.022

Rank 3 · TkA08G173810 · TK1151

Cell membrane0.019

Rank 4 · TkA08G173810 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA08G173810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding14-61 aa

PF23082Myb_DNA-binding_216-35 aa

PF13921Myb_DNA-bind_617-76 aa

PF00249Myb_DNA-binding67-112 aa

PF13921Myb_DNA-bind_671-116 aa

PF23082Myb_DNA-binding_287-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G173810	`PF00249`	Myb_DNA-binding	14	61	8.7e-36	122.5
TkA08G173810	`PF23082`	Myb_DNA-binding_2	16	35	0.04	14.7
TkA08G173810	`PF13921`	Myb_DNA-bind_6	17	76	3.1e-20	72.8
TkA08G173810	`PF00249`	Myb_DNA-binding	67	112	8.7e-36	122.5
TkA08G173810	`PF13921`	Myb_DNA-bind_6	71	116	3.1e-20	72.8
TkA08G173810	`PF23082`	Myb_DNA-binding_2	87	103	0.04	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ07`	Arabidopsis thaliana	sp\|Q9FJ07\|MY111_ARATH Transcription factor MYB111	75.000%	Swiss-Prot	Low
`O22264`	Arabidopsis thaliana	sp\|O22264\|MYB12_ARATH Transcription factor MYB12	62.300%	Swiss-Prot	Medium
`Q9LZK4`	Arabidopsis thaliana	sp\|Q9LZK4\|MYB11_ARATH Transcription factor MYB11	61.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card