Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1059 bp · TkA08G168810|TK1151|cDNA
CTTAAAGCTAACACTAAAGACCGATTTTTGGGTGAATATTTATTTGCGTATACTCTGAATTTAGGGTCTCCACTCAACGCAGAATCACAGCCTCATACTATAACAACCCTCACACTCGCTCTACTCCGCCTCTCTCACATCTTTCTCGAACTATACACACCCTTTCATAATGGCGTTGCCGAATCAGCAAACTGTTGATTACCCGAGTTTCAAGCTTGTAATCGTCGGCGATGGTGGAACTGGAAAAACCACTTTCGTGA...
666 bp · TkA08G168810|TK1151|CDS
ATGGCGTTGCCGAATCAGCAAACTGTTGATTACCCGAGTTTCAAGCTTGTAATCGTCGGCGATGGTGGAACTGGAAAAACCACTTTCGTGAAGAGACATTTAACTGGAGAATTCGAGAAGAAATACGAACCAACCATTGGTGTTGAGGTTCACCCCTTGGATTTCTTCACCAACTGTGGAAAGATCCGATTTTACTGCTGGGACACAGCTGGACAGGAGAAATTTGGTGGTCTTCGTGATGGATATTACATTCATGGTCA...
Protein
Download Protein FASTA221 aa · TkA08G168810|TK1151|PROTEIN
MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDIAAQQQHEAELAAAASQPLPDDDDDAFE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G168810 |
|---|---|
| TK1151 ID | TkA08G168810 |
| OH-1004 ID | LXL04_004057 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 81.100 |
| Protein coverage (%) | TK1151 40.724 / OH-1004 26.087Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G168810 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:44148636-44150884 (+) | |||||||||
| Description | Similar to RAN3: GTP-binding nuclear protein Ran-3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000054 ribosomal subunit export from nucleus Biological Process GO:0006606 protein import into nucleus Biological Process GO:0042742 defense response to bacterium Biological Process GO:0050832 defense response to fungus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009506 plasmodesma Cellular Component GO:0009536 plastid Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT5G20010 ath:AT5G55190 nta:107779563 nta:107829920 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF27394Aq_aa274-31 aaPF00025Arf13-138 aaPF04665Pox_A3213-41 aaPF00503G-alpha13-32 aaPF00735Septin13-33 aaPF00071Ras15-171 aaPF08477Roc15-128 aaPF00009GTP_EFTU15-34 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G168810 | PF27394 | Aq_aa27 | 4 | 31 | 0.14 | 12.7 |
| TkA08G168810 | PF00025 | Arf | 13 | 138 | 8.6e-11 | 42.3 |
| TkA08G168810 | PF04665 | Pox_A32 | 13 | 41 | 0.023 | 14.9 |
| TkA08G168810 | PF00503 | G-alpha | 13 | 32 | 0.035 | 14.0 |
| TkA08G168810 | PF00735 | Septin | 13 | 33 | 0.22 | 11.5 |
| TkA08G168810 | PF00071 | Ras | 15 | 171 | 1.2e-47 | 162.3 |
| TkA08G168810 | PF08477 | Roc | 15 | 128 | 2e-30 | 106.2 |
| TkA08G168810 | PF00009 | GTP_EFTU | 15 | 34 | 0.0029 | 18.0 |
| TkA08G168810 | PF13479 | AAA_24 | 15 | 32 | 0.094 | 13.1 |
| TkA08G168810 | PF12775 | AAA_7 | 15 | 44 | 0.24 | 11.6 |
| TkA08G168810 | PF01926 | MMR_HSR1 | 16 | 126 | 0.00015 | 22.5 |
| TkA08G168810 | PF03193 | RsgA_GTPase | 16 | 33 | 0.047 | 14.2 |
| TkA08G168810 | PF13401 | AAA_22 | 16 | 36 | 0.24 | 12.4 |
| TkA08G168810 | PF13191 | AAA_16 | 16 | 38 | 0.33 | 12.2 |
| TkA08G168810 | PF00910 | RNA_helicase | 17 | 139 | 0.00014 | 23.0 |
| TkA08G168810 | PF06745 | ATPase | 17 | 58 | 0.052 | 13.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.