TkA08G164200 | RubberDandelionOmics

Gene overview

TkA08G164200

Reference: TK1151 Chr: Chr08 Coordinates: 42904148-42905834 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

516 bp · TkA08G164200|TK1151|cDNA

ATGGATTCTTCAGATATAGAGCTGCTTTCTGCTATTCAGGATGTTTTGCTGGAGTTTCGTGCTGGTAAAATGCATTTGGAAGGAACATGTGTTGTTGCTGATCCACGTAAAGGACTTGTCTGCATTGGAAGAGGGGAGGAGGGTTTAGTTCATATTCAGTGGCTTGATAGGAGTACCAACACCATTGAAGATGTTGGTCAAGCTTCTGGAAGAGTTTACTTATTAAAGTTTGAAACAGATGGCCGTAAATGTTTCTTCTG...

CDS

Download CDS FASTA

516 bp · TkA08G164200|TK1151|CDS

ATGGATTCTTCAGATATAGAGCTGCTTTCTGCTATTCAGGATGTTTTGCTGGAGTTTCGTGCTGGTAAAATGCATTTGGAAGGAACATGTGTTGTTGCTGATCCACGTAAAGGACTTGTCTGCATTGGAAGAGGGGAGGAGGGTTTAGTTCATATTCAGTGGCTTGATAGGAGTACCAACACCATTGAAGATGTTGGTCAAGCTTCTGGAAGAGTTTACTTATTAAAGTTTGAAACAGATGGCCGTAAATGTTTCTTCTG...

Protein

Download Protein FASTA

171 aa · TkA08G164200|TK1151|PROTEIN

MDSSDIELLSAIQDVLLEFRAGKMHLEGTCVVADPRKGLVCIGRGEEGLVHIQWLDRSTNTIEDVGQASGRVYLLKFETDGRKCFFWMQEPRADEDEELCKSSAIIFVVASSTNKEDTKFKRFWIQSNTRKCSSGEDVQVVENGDVEMSKFKDGNHMFYYGNVTTEFATES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G164200`
TK1151 ID	TkA08G164200
OH-1004 ID	LXL04_003051
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	85.200
Protein coverage (%)	TK1151 59.649 / OH-1004 38.591 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G164200

Location Chr08:42904148-42905834 (+)

Description Similar to RPN13: 26S proteasome regulatory subunit RPN13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26590`	Functions as a proteasomal ubiquitin receptor.	The defective proteasome but not substrate recognition function is responsible for the null phenotypes of the Arabidopsis proteasome subunit RPN10.2011 · DOI: 10.1105/tpc.111.086702

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003051 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0043248 proteasome assembly Biological Process

GO:0061136 regulation of proteasomal protein catabolic process Biological Process

GO:0071357 cellular response to type I interferon Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G26590

hsa:11047

xtr:394646

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · TkA08G164200 · TK1151

Nucleus0.454

Rank 2 · TkA08G164200 · TK1151

Cell membrane0.109

Rank 3 · TkA08G164200 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA08G164200 · TK1151

Golgi apparatus0.067

Rank 5 · TkA08G164200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04683Rpn13_ADRM1_Pru16-100 aa

PF04683Rpn13_ADRM1_Pru118-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G164200	`PF04683`	Rpn13_ADRM1_Pru	16	100	1.8e-22	80.4
TkA08G164200	`PF04683`	Rpn13_ADRM1_Pru	118	130	1.8e-22	80.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48726`	Arabidopsis thaliana	sp\|O48726\|RPN13_ARATH 26S proteasome regulatory subunit RPN13	57.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card