TkA08G164190 | RubberDandelionOmics

Gene overview

TkA08G164190

Reference: TK1151 Chr: Chr08 Coordinates: 42896683-42898980 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1863 bp · TkA08G164190|TK1151|cDNA

TTTTACTTTAAAACATTTTGATAAATACAAATCAGCAAGCTCCTTCAGGGGTTTTTCCAACTTGATTTGAATTCAACATGTTCAAAACGCCACTTGCAGTCAACTCTATGCTCTCTTCTCTCTATAAATAAGACACTGCCATAGATCTAACTCACCAAATTAAACATGAAGAAGTCTCAAATGAGCTTTTCTGTGTTCCTTCTTGTTCTAACTCTTTCCTTTTCAAATTCCTCGGCAACGTTATCTTCCCTTGTTGATGT...

CDS

Download CDS FASTA

1611 bp · TkA08G164190|TK1151|CDS

ATGAAGAAGTCTCAAATGAGCTTTTCTGTGTTCCTTCTTGTTCTAACTCTTTCCTTTTCAAATTCCTCGGCAACGTTATCTTCCCTTGTTGATGTAGGATCTGAAAATTTCATAAGTTGCACACAATCGAATTCCAACAATGCTACCTCCACCTCTCAGCTCATTTTCACCCCTGTCAATGCTTCTTTCATTCCCATTTGGCAAGACAGAGTGCAAAACACTAGGTTCCTTAAACCCTCCACTCCTAAACCATCCGTCAT...

Protein

Download Protein FASTA

536 aa · TkA08G164190|TK1151|PROTEIN

MKKSQMSFSVFLLVLTLSFSNSSATLSSLVDVGSENFISCTQSNSNNATSTSQLIFTPVNASFIPIWQDRVQNTRFLKPSTPKPSVIVTPVDETMIQAVLFCAKKHGYEIRIRSGGHDWEGLSYSADVPFVMLDLNNMRSIDLDIAKRTAWVQPAATLGELYYSISQKTDTLYFPAGVCPTVGLGGYIGGGGYGNLMRKYGTGADNVLDVRFMDVNGNIFDRKSMGKDLFWAIRGGGASSFGIVLAWKLQLVPVPEKVTV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G164190`
TK1151 ID	TkA08G164190
OH-1004 ID	LXL04_032305
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G164190

Location Chr08:42896683-42898980 (+)

Description Similar to Tetrahydrocannabinolic acid synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44380`	Berberine bridge enzyme-like 24.	No verified direct reference in this release
`At5g44390`	Berberine bridge enzyme-like 25.	No verified direct reference in this release
`At5g44440`	Involved in adaptation to salt stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032305 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:1901696 cannabinoid biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0050328 tetrahydroberberine oxidase activity Molecular Function

GO:0071949 FAD binding Molecular Function

GO:0102778 delta9-tetrahydrocannabinolate synthase activity Molecular Function

KEGG gene cross-reference

ag:ADY15026

ag:BAC41356

ath:AT5G44390

ath:AT5G44400

ath:AT5G44440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.512

Rank 1 · TkA08G164190 · TK1151

Endoplasmic reticulum0.143

Rank 2 · TkA08G164190 · TK1151

Lysosome / Vacuole0.124

Rank 3 · TkA08G164190 · TK1151

Cytoplasm0.113

Rank 4 · TkA08G164190 · TK1151

Cell membrane0.088

Rank 5 · TkA08G164190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01565FAD_binding_484-220 aa

PF08031BBE479-534 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G164190	`PF01565`	FAD_binding_4	84	220	4.8e-25	88.6
TkA08G164190	`PF08031`	BBE	479	534	8.6e-15	55.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKV0`	Arabidopsis thaliana	sp\|Q9FKV0\|BBE24_ARATH Berberine bridge enzyme-like 24	44.900%	Swiss-Prot	Medium
`Q9FKU9`	Arabidopsis thaliana	sp\|Q9FKU9\|BBE25_ARATH Berberine bridge enzyme-like 25	45.000%	Swiss-Prot	Medium
`Q9FI21`	Arabidopsis thaliana	sp\|Q9FI21\|BBE28_ARATH Berberine bridge enzyme-like 28	43.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card