TkA08G163990 | RubberDandelionOmics

Gene overview

TkA08G163990

Reference: TK1151 Chr: Chr08 Coordinates: 42812762-42814280 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1034 bp · TkA08G163990|TK1151|cDNA

ATGGATCTTTTAAAAAATTATGCAGTCTCTGGTAGTAAAAGGAAGGCACAAAACTTCAAAGATGAGGAGTTTCATTTTGAGGCAGGTCTCTCAGTCAGAGGTAACGGAGGCTTCAATTCCAACAGATTGGAGTCTGCTGTACTTGACTTAGCTGCAGATGATAACGGTGGATTACAAAAACAGAAGTCTTCATTTCATTGGGACAAGAGGAGTAAAAAAATACGTGAAGTTGAACAATGGTGACCGTGTGTCCGCTAGTG...

CDS

Download CDS FASTA

462 bp · TkA08G163990|TK1151|CDS

ATGATAACGGTGGATTACAAAAACAGAAGTCTTCATTTCATTGGGACAAGAGGAGTAAAAAAATACGTGAAGTTGAACAATGGTGACCGTGTGTCCGCTAGTGGAAAGATATTAACAGAGAGTGGTAAAAAAGGGAAAGCGAATAAAACAGGAATATATAAAAGATGGAAAGAAAAGTCACACAATAAGATATCTTCCAACAATGAAGGTAGTAGTAATGCTATGGATACTACAAGTCTCAAAGGTGGTGGAATGCAAAG...

Protein

Download Protein FASTA

153 aa · TkA08G163990|TK1151|PROTEIN

MITVDYKNRSLHFIGTRGVKKYVKLNNGDRVSASGKILTESGKKGKANKTGIYKRWKEKSHNKISSNNEGSSNAMDTTSLKGGGMQRGRNNRGFKGRMVPNAHVKSEVKNLEQVRKDRQTKATKAAFMKSNPKKGKKMGKMVVKGVKVENDES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G163990`
TK1151 ID	TkA08G163990
OH-1004 ID	LXL04_032295
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 77.778 / OH-1004 14.510 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G163990

Location Chr08:42812762-42814280 (-)

Description Similar to RH29: Putative DEAD-box ATP-dependent RNA helicase 29

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77030`	Putative DEAD-box ATP-dependent RNA helicase 29.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YV85`	DEAD-box ATP-dependent RNA helicase 29.	No verified direct reference in this release
`Os08g0416100`	DEAD-box ATP-dependent RNA helicase 29.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032295 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006396 RNA processing Biological Process

GO:0009409 response to cold Biological Process

GO:0016070 RNA metabolic process Biological Process

GO:0030520 estrogen receptor signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G77030

dosa:Os08g0416100

hsa:79039

mmu:71990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.876

Rank 1 · TkA08G163990 · TK1151

Cytoplasm0.184

Rank 2 · TkA08G163990 · TK1151

Mitochondrion0.017

Rank 3 · TkA08G163990 · TK1151

Extracellular0.014

Rank 4 · TkA08G163990 · TK1151

Cell membrane0.014

Rank 5 · TkA08G163990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08147DBP10CT20-59 aa

PF26638DUF821151-136 aa

PF08147DBP10CT132-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G163990	`PF08147`	DBP10CT	20	59	6.2e-05	23.9
TkA08G163990	`PF26638`	DUF8211	51	136	0.2	12.9
TkA08G163990	`PF08147`	DBP10CT	132	132	6.2e-05	23.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49289`	Arabidopsis thaliana	sp\|O49289\|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29	56.800%	Swiss-Prot	High
`A2YV85`	Oryza sativa subsp. indica	sp\|A2YV85\|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29	46.300%	Swiss-Prot	Medium
`A3BT52`	Oryza sativa subsp. japonica	sp\|A3BT52\|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29	46.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card