TkA08G163880 | RubberDandelionOmics

Gene overview

TkA08G163880

Reference: TK1151 Chr: Chr08 Coordinates: 42778904-42779278 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

375 bp · TkA08G163880|TK1151|cDNA

ATGACCCTTTTGACCGGAACCACCGTCGAGTACATGCGTCCAAGGATGTCTTTCGCAGCGGCGATGATCGGCGTCGACGACTTTCTCTACGCCTGCGGAGTCTCCCGCCTCCCTGTCTCCACCACCTCCCTCATCATCGCGTCGCAACTAGGATTCACCGCGTTCTACGCGATTCTGTTGGTGAAACAGAAATTCACGCCGTATTCGATCACGGCGTTGTATGGACTGGTGTTGCCGATGGTGGAGATGACGTATAACAA...

CDS

Download CDS FASTA

375 bp · TkA08G163880|TK1151|CDS

ATGACCCTTTTGACCGGAACCACCGTCGAGTACATGCGTCCAAGGATGTCTTTCGCAGCGGCGATGATCGGCGTCGACGACTTTCTCTACGCCTGCGGAGTCTCCCGCCTCCCTGTCTCCACCACCTCCCTCATCATCGCGTCGCAACTAGGATTCACCGCGTTCTACGCGATTCTGTTGGTGAAACAGAAATTCACGCCGTATTCGATCACGGCGTTGTATGGACTGGTGTTGCCGATGGTGGAGATGACGTATAACAA...

Protein

Download Protein FASTA

124 aa · TkA08G163880|TK1151|PROTEIN

MTLLTGTTVEYMRPRMSFAAAMIGVDDFLYACGVSRLPVSTTSLIIASQLGFTAFYAILLVKQKFTPYSITALYGLVLPMVEMTYNKAKQAITYTLVTNSGQKGHMRTILKSSWINGAQKKIRD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G163880`
TK1151 ID	TkA08G163880
OH-1004 ID	LXL04_016948
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	85.700
Protein coverage (%)	TK1151 92.742 / OH-1004 66.854 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G163880

Location Chr08:42778904-42779278 (+)

Description Similar to PUP2: Purine permease 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33750`	Mediates adenine transport.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x
`At1g28230`	Proton-coupled purine transporter mediating adenine and trans-zeatin uptake.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x Recycling of pyridoxine (vitamin B6) by PUP1 in Arabidopsis.2013 · DOI: 10.1111/tpj.12195
`At4g18220`	Purine permease 21.	No verified direct reference in this release
`At4g18210`	Probable purine permease 10.	No verified direct reference in this release
`At4g18195`	Probable purine permease 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016948 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006863 purine nucleobase transport Biological Process

GO:0010184 cytokinin transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005345 purine nucleobase transmembrane transporter activity Molecular Function

GO:0015211 purine nucleoside transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G28220

ath:AT1G28230

ath:AT2G33750

ath:AT4G18195

ath:AT4G18220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.389

Rank 1 · TkA08G163880 · TK1151

Cell membrane0.206

Rank 2 · TkA08G163880 · TK1151

Golgi apparatus0.206

Rank 3 · TkA08G163880 · TK1151

Lysosome / Vacuole0.143

Rank 4 · TkA08G163880 · TK1151

Cytoplasm0.117

Rank 5 · TkA08G163880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16913PUNUT21-72 aa

PF00892EamA27-73 aa

PF16913PUNUT71-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G163880	`PF16913`	PUNUT	21	72	1.2e-17	64.9
TkA08G163880	`PF00892`	EamA	27	73	0.0013	19.8
TkA08G163880	`PF16913`	PUNUT	71	98	1.2e-17	64.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94GB1`	Arabidopsis thaliana	sp\|Q94GB1\|PUP2_ARATH Purine permease 2	38.300%	Swiss-Prot	Medium
`Q9FZ96`	Arabidopsis thaliana	sp\|Q9FZ96\|PUP1_ARATH Purine permease 1	39.700%	Swiss-Prot	Medium
`O49726`	Arabidopsis thaliana	sp\|O49726\|PUP21_ARATH Purine permease 21	44.600%	Swiss-Prot	Medium
`O49725`	Arabidopsis thaliana	sp\|O49725\|PUP10_ARATH Probable purine permease 10	43.100%	Swiss-Prot	Medium
`Q0WRB9`	Arabidopsis thaliana	sp\|Q0WRB9\|PUP8_ARATH Probable purine permease 8	40.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card