TkA08G163530 | RubberDandelionOmics

Gene overview

TkA08G163530

Reference: TK1151 Chr: Chr08 Coordinates: 42664429-42666155 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1016 bp · TkA08G163530|TK1151|cDNA

TTCTGCGTTTCTTCGTACAGTCTTCCTACTGTATCCCCAATATATCGATTACCCGTCTTCCAAAACCCTATCATCGACTTCGATTCCCATTCAAAATTTTCTGAATTTTGAACGTTCTCCTTGTATATCAATTTTATCCGTGGAATTACGATCTGCTATAGATTGGATCATCGAAACGCATGCTAAGTACTTGAAACTTTCAGCTTCTCAAAGTAAAGATGGTGAAGCTGACGATGATTGCCCGTGTCACTGATGGCCTT...

CDS

Download CDS FASTA

657 bp · TkA08G163530|TK1151|CDS

ATGGTGAAGCTGACGATGATTGCCCGTGTCACTGATGGCCTTCCACTAGCTGAAGGACTGGATGATGGTCGTGACATGCAAGATGCAGAGTTCTACAAACAGCAAGTGAAGGCATTGTTCAAAAACCTTTCAAGAGGACAAAATGAAGCCTCACGAATGTCCATAGAAACTGGCCCTTATGTTTTCCATTATATCATTGAAGGGCGAGTGTGTTATTTGACAATGTGTGATCGTGCTTACCCAAAGAAACTTGCCTTCCA...

Protein

Download Protein FASTA

218 aa · TkA08G163530|TK1151|PROTEIN

MVKLTMIARVTDGLPLAEGLDDGRDMQDAEFYKQQVKALFKNLSRGQNEASRMSIETGPYVFHYIIEGRVCYLTMCDRAYPKKLAFQYLEDLKNEFERGYENQIETAARPYAFIKFDTFIQRTKKLYQDTRTQRNISKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSQMSSRLTSDTRIYADKARDLNRQALIKKWAPVAIVVGFVILLLWAKNKIW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G163530`
TK1151 ID	TkA08G163530
OH-1004 ID	LXL04_032280
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G163530

Location Chr08:42664429-42666155 (+)

Description Similar to SEC22: 25.3 kDa vesicle transport protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11890`	V-SNARE involved in vesicle trafficking from the ER to the Golgi complex and required for early secretion.	Arabidopsis SNARE protein SEC22 is essential for gametophyte development and maintenance of Golgi-stack integrity.2011 · DOI: 10.1111/j.1365-313x.2011.04487.x Caesium accumulation in yeast and plants is selectively repressed by loss of the SNARE Sec22p/SEC22.2013 · DOI: 10.1038/ncomms3092

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032280 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0007030 Golgi organization Biological Process

GO:0009267 cellular response to starvation Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0016236 macroautophagy Biological Process

GO:0045732 positive regulation of protein catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G11890

hsa:9554

mmu:20333

pon:100172644

rno:310710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.577

Rank 1 · TkA08G163530 · TK1151

Cytoplasm0.318

Rank 2 · TkA08G163530 · TK1151

Endoplasmic reticulum0.274

Rank 3 · TkA08G163530 · TK1151

Lysosome / Vacuole0.125

Rank 4 · TkA08G163530 · TK1151

Cell membrane0.112

Rank 5 · TkA08G163530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13774Longin29-120 aa

PF04102SlyX33-49 aa

PF13402Peptidase_M6099-180 aa

PF00957Synaptobrevin117-129 aa

PF04102SlyX132-174 aa

PF11855DUF3375133-192 aa

PF00957Synaptobrevin135-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G163530	`PF13774`	Longin	29	120	8.6e-30	103.5
TkA08G163530	`PF04102`	SlyX	33	49	1.4	10.3
TkA08G163530	`PF13402`	Peptidase_M60	99	180	0.13	12.4
TkA08G163530	`PF00957`	Synaptobrevin	117	129	1.3e-17	64.1
TkA08G163530	`PF04102`	SlyX	132	174	1.4	10.3
TkA08G163530	`PF11855`	DUF3375	133	192	0.03	13.9
TkA08G163530	`PF00957`	Synaptobrevin	135	213	1.3e-17	64.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AU2`	Arabidopsis thaliana	sp\|Q94AU2\|SC221_ARATH 25.3 kDa vesicle transport protein SEC22-1	87.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card