TkA08G163170 | RubberDandelionOmics

Gene overview

TkA08G163170

Reference: TK1151 Chr: Chr08 Coordinates: 42562327-42564192 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1210 bp · TkA08G163170|TK1151|cDNA

CTGATTCTCCCCCTCTTGCATTAGTCTGGCTGCAACGGCGAAATACTGAACCCTAACACCGCAGCTTAGAGCAAAGCCGCAACCATGGCACAACCTAAAGTTTTGACGCCGAAGGAGGCGATATTCAAATGATGTTGTCTGCCGAAGTCCATCTCGGCACCAAGAACTGTGATTTTCAGATGGAACGTTACGTGTTTAAGCGCCGCAACGACGGAATTTACATCATTAACCTAGGAAAGACATGGGAGAAGCTCCAGATG...

CDS

Download CDS FASTA

708 bp · TkA08G163170|TK1151|CDS

ATGATGTTGTCTGCCGAAGTCCATCTCGGCACCAAGAACTGTGATTTTCAGATGGAACGTTACGTGTTTAAGCGCCGCAACGACGGAATTTACATCATTAACCTAGGAAAGACATGGGAGAAGCTCCAGATGGCTGCCAGAGTGATTGTCGCAATCGAAAACCCCCCAGACATTATCGTCCAATCTGCCAGACCCTACGGACAAAGAGCTGTACTAACTGAAATTCGCTCAGTACACAGGCTGCCACGCCATTGCTGGTC...

Protein

Download Protein FASTA

235 aa · TkA08G163170|TK1151|PROTEIN

MMLSAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIENPPDIIVQSARPYGQRAVLTEIRSVHRLPRHCWSSHSRYFTNQLQTSFSEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFWLLARMVLQMRGVINQGHKWDVMVDLFFYREPEEAKEPNEEDNAATADYPDYTAGALAWVTTGQPRFLMLNGLVT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G163170`
TK1151 ID	TkA08G163170
OH-1004 ID	LXL04_032274
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 92.340 / OH-1004 72.241 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G163170

Location Chr08:42562327-42564192 (-)

Description Similar to 179B: 40S ribosomal protein SA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04770`	Required for the assembly and/or stability of the 40S ribosomal subunit.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032274 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000028 ribosomal small subunit assembly Biological Process

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT3G04770

bna:106354211

cam:101509570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.315

Rank 1 · TkA08G163170 · TK1151

Cytoplasm0.277

Rank 2 · TkA08G163170 · TK1151

Nucleus0.148

Rank 3 · TkA08G163170 · TK1151

Peroxisome0.123

Rank 4 · TkA08G163170 · TK1151

Extracellular0.069

Rank 5 · TkA08G163170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00318Ribosomal_S22-55 aa

PF00318Ribosomal_S296-167 aa

PF1612240S_SA_C187-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G163170	`PF00318`	Ribosomal_S2	2	55	5.2e-22	78.9
TkA08G163170	`PF00318`	Ribosomal_S2	96	167	5.2e-22	78.9
TkA08G163170	`PF16122`	40S_SA_C	187	216	0.083	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H173`	Arabidopsis thaliana	sp\|Q8H173\|RSSA2_ARATH Small ribosomal subunit protein uS2y	79.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card