TkA08G160450 | RubberDandelionOmics

Gene overview

TkA08G160450

Reference: TK1151 Chr: Chr08 Coordinates: 41856451-41860979 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2388 bp · TkA08G160450|TK1151|cDNA

AAAAAATTGAAGTCGTTATAATTTTTATACAAAAAAGACTTCTGAACTAAATGGTCAAAATAGTAATGAATTCCCTTTATACATGCCAACATAATACAGCTGCATTTTCTCAAAGTCGTTGTAAAACCTAATTCAAATTGCCCAATCCTAATTCACAAATTAGGGTTTATTTCGAATTTGTGAAGAAATACTTGTAGTGATTTATCGAGTAGATTTATATAAATTGAGCGGACCCATTCTCGTCTCTTTCGACTAACCTT...

CDS

Download CDS FASTA

1773 bp · TkA08G160450|TK1151|CDS

ATGATGGCGGATGGGTCATCGTCATCCCCAATTCAATCAGCCATCACCAACGTCACCACATCCATGGATCAACAACAGCAGCAGCAATCGATTTCTCAAAACCTCTCTTCTGCAATCGACACCACCATTGGTCAAATCATGTCAACCCCATCATTGCCATCTCAGCAACAACAACAGCAACAACTGCCACAAGTTAATTCATCCAACGTTATGTCACAGCAACAACAACAACAATTACTTCAACATCAACAGCAGCAGAG...

Protein

Download Protein FASTA

590 aa · TkA08G160450|TK1151|PROTEIN

MMADGSSSSPIQSAITNVTTSMDQQQQQQSISQNLSSAIDTTIGQIMSTPSLPSQQQQQQQLPQVNSSNVMSQQQQQQLLQHQQQQSNLMGSANFQIHQQGLQRSPSITRLNHMQQQQQQQQQYNMSANNAARIYGQMNFASGQQQMPQQQQQQNQQIGQIGNNATLARSGLMGQTGHMTMLPGQAAATAQLSLQSQLLASPRQKTGLVQGSQYHPGNTPGQSLQGMQMGMNIMGSYNLNPQIRANGALAFSQQRINQGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G160450`
TK1151 ID	TkA08G160450
OH-1004 ID	LXL04_032233
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G160450

Location Chr08:41856451-41860979 (-)

Description Similar to TAF12B: Transcription initiation factor TFIID subunit 12b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: B2C6R6`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	No verified direct reference in this release
`At1g17440`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	Arabidopsis enhanced ethylene response 4 encodes an EIN3-interacting TFIID transcription factor required for proper ethylene response, including ERF1 induction.2007 · DOI: 10.1093/jxb/erm080
`At3g10070`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032233 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006282 regulation of DNA repair Biological Process

GO:0006352 DNA-templated transcription initiation Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010104 regulation of ethylene-activated signaling pathway Biological Process

GO:0042789 mRNA transcription by RNA polymerase II Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G17440

ath:AT3G10070

hsa:6883

mmu:66464

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkA08G160450 · TK1151

Cytoplasm0.166

Rank 2 · TkA08G160450 · TK1151

Cell membrane0.012

Rank 3 · TkA08G160450 · TK1151

Mitochondrion0.012

Rank 4 · TkA08G160450 · TK1151

Lysosome / Vacuole0.007

Rank 5 · TkA08G160450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03847TFIID_20kDa431-504 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G160450	`PF03847`	TFIID_20kDa	431	504	1.3e-28	99.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B2C6R6`	Arabidopsis thaliana	sp\|B2C6R6\|TAFCL_ARATH Transcription initiation factor TFIID subunit 12b	51.600%	Swiss-Prot	High
`Q940A7`	Arabidopsis thaliana	sp\|Q940A7\|TA12B_ARATH Transcription initiation factor TFIID subunit 12b	52.000%	Swiss-Prot	High
`Q9SR71`	Arabidopsis thaliana	sp\|Q9SR71\|TAF12_ARATH Transcription initiation factor TFIID subunit 12	36.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card