TkA08G158520 | RubberDandelionOmics

Gene overview

TkA08G158520

Reference: TK1151 Chr: Chr08 Coordinates: 41272089-41274769 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1853 bp · TkA08G158520|TK1151|cDNA

AAATTAGTCTGATCATGTTCTCATGATTAACCATCAACCACAAAGGCACCAATTGAACAAGTTCTTTTCCATTAAAGCACGTTTACAATTAGGTTGCCGGCGGAATCTCCGGTGGAGCCACTACGAAAATGTCGACACCATCTCAATTCACCTACTTCTTATTTTTATACAAAATATTCGTAAATTCAACCATTTCTCCCTGTATTTCACCTCCCTCCCAATGAACTACGATGCTCATAATCTCACACCTTCCTCACCCT...

CDS

Download CDS FASTA

1167 bp · TkA08G158520|TK1151|CDS

ATGGTGGGAGTTAGGAGAAAAATACATGAGAATCCAGAGCTGATGTACCAAGAATTTGAGACCAGTAAAGTTATTAGAGAAGAATTGGATAAATTGGGGATTTCATACAAACACCCAATTGCAGTTACCGGCGTTGTTGGATTCATCGGCTCCGGAGAACCTCCGTTTGTCGCTCTAAGGGCAGATATGGATGCTCTTTCCATGCAGGAAATGGTGGAATGGAAACACAAAAGTAAAGTTCCTGGAAAGATGCATGCATG...

Protein

Download Protein FASTA

388 aa · TkA08G158520|TK1151|PROTEIN

MVGVRRKIHENPELMYQEFETSKVIREELDKLGISYKHPIAVTGVVGFIGSGEPPFVALRADMDALSMQEMVEWKHKSKVPGKMHACGHDGHVTMLLGAAKILKTHSHLLKGTVVLIFQPAEEGGGGAKQVVDSGSLENVKAIFGLHVSPQQPIGQVFSKSGPILAGSGVFEAVITGKGGHAAIPHHSIDPILAASNVVVSLQHLVSREADPLDSQVVTVAKFQGGGAFNVIPDSVSIGGTFRAFSKESFMQLRQRIEEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G158520`
TK1151 ID	TkA08G158520
OH-1004 ID	LXL04_032170
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 90.023 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G158520

Location Chr08:41272089-41274769 (+)

Description Similar to ILL4: IAA-amino acid hydrolase ILR1-like 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51760`	May hydrolyze auxin-amino acid conjugates.	IAR3 encodes an auxin conjugate hydrolase from Arabidopsis.1999 · DOI: 10.1105/tpc.11.3.365 Characterization of a family of IAA-amino acid conjugate hydrolases from Arabidopsis.2002 · DOI: 10.1074/jbc.m111955200 A family of auxin-conjugate hydrolases that contributes to free indole-3-acetic acid levels during Arabidopsis germination.2004 · DOI: 10.1104/pp.104.039677 The amidohydrolases IAR3 and ILL6 contribute to jasmonoyl-isoleucine hormone turnover and generate 12-hydroxyjasmonic acid upon wounding in Arabidopsis leaves.2013 · DOI: 10.1074/jbc.m113.499228
`At1g51780`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release
`At5g56660`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA), including IAA-Ala, IAA-Leu, IAA-Met, IAA-Phe, IAA-Ser, IAA-Thr, IAA-Tyr and IAA-Val.	Characterization of a family of IAA-amino acid conjugate hydrolases from Arabidopsis.2002 · DOI: 10.1074/jbc.m111955200 A family of auxin-conjugate hydrolases that contributes to free indole-3-acetic acid levels during Arabidopsis germination.2004 · DOI: 10.1104/pp.104.039677

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0560000`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release
`UniProt: Q84XG9`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032170 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009850 auxin metabolic process Biological Process

GO:0010112 regulation of systemic acquired resistance Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010178 IAA-amino acid conjugate hydrolase activity Molecular Function

GO:0010179 IAA-Ala conjugate hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G51760

ath:AT1G51780

ath:AT5G56660

dosa:Os01g0560000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.400

Rank 1 · TkA08G158520 · TK1151

Cytoplasm0.400

Rank 2 · TkA08G158520 · TK1151

Mitochondrion0.143

Rank 3 · TkA08G158520 · TK1151

Nucleus0.143

Rank 4 · TkA08G158520 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA08G158520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01546Peptidase_M2058-372 aa

PF07687M20_dimer80-93 aa

PF04389Peptidase_M2893-145 aa

PF07687M20_dimer167-261 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G158520	`PF01546`	Peptidase_M20	58	372	3.6e-41	142.1
TkA08G158520	`PF07687`	M20_dimer	80	93	7.9e-11	42.6
TkA08G158520	`PF04389`	Peptidase_M28	93	145	0.18	12.2
TkA08G158520	`PF07687`	M20_dimer	167	261	7.9e-11	42.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04373`	Arabidopsis thaliana	sp\|O04373\|ILL4_ARATH IAA-amino acid hydrolase ILR1-like 4	69.900%	Swiss-Prot	High
`Q9SWX9`	Arabidopsis thaliana	sp\|Q9SWX9\|ILL5_ARATH IAA-amino acid hydrolase ILR1-like 5	62.900%	Swiss-Prot	High
`P54970`	Arabidopsis thaliana	sp\|P54970\|ILL2_ARATH IAA-amino acid hydrolase ILR1-like 2	62.000%	Swiss-Prot	High
`Q8S9S4`	Oryza sativa subsp. japonica	sp\|Q8S9S4\|ILL1_ORYSJ IAA-amino acid hydrolase ILR1-like 1	67.800%	Swiss-Prot	High
`Q84XG9`	Oryza sativa subsp. indica	sp\|Q84XG9\|ILL1_ORYSI IAA-amino acid hydrolase ILR1-like 1	67.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card