TkA08G158510 | RubberDandelionOmics

Gene overview

TkA08G158510

Reference: TK1151 Chr: Chr08 Coordinates: 41268806-41270083 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

608 bp · TkA08G158510|TK1151|cDNA

CCTTAACCTATAATCTTGCCTAAAATAACCCAATATATCCAATGCCAGATGCGGGTGTAGATATCATTCAAACCACCGTGCAAATTCTTCTTAATCGTGTAACAAATGGCAAAAATCATGCCAACAAACTTCCACCATCTATACACACAGTACCTAGTATGTTCCGAGATCAAAGCCCAATTTCTTTCAACCCACGTGTCGTCTCCATTGGACCTCTTCACAAAGAAGACAAGAAGCTACAAGAATTCGAAGTACATAAA...

CDS

Download CDS FASTA

402 bp · TkA08G158510|TK1151|CDS

ATGCCAGATGCGGGTGTAGATATCATTCAAACCACCGTGCAAATTCTTCTTAATCGTGTAACAAATGGCAAAAATCATGCCAACAAACTTCCACCATCTATACACACAGTACCTAGTATGTTCCGAGATCAAAGCCCAATTTCTTTCAACCCACGTGTCGTCTCCATTGGACCTCTTCACAAAGAAGACAAGAAGCTACAAGAATTCGAAGTACATAAAGAATCTTCAGTCCATAATCTACTACGTCGTTTAGATTCCTC...

Protein

Download Protein FASTA

133 aa · TkA08G158510|TK1151|PROTEIN

MPDAGVDIIQTTVQILLNRVTNGKNHANKLPPSIHTVPSMFRDQSPISFNPRVVSIGPLHKEDKKLQEFEVHKESSVHNLLRRLDSSPEKTLQSCVQKVNDSIDQIRGCYAGMKAYNDVELSNMMVRMLRLRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G158510`
TK1151 ID	TkA08G158510
OH-1004 ID	LXL04_032171
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.737 / OH-1004 29.439 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G158510`
Location	Chr08:41268806-41270083 (+)
Description	Similar to At3g47200: UPF0481 protein At3g47200
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032171` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	ath:AT3G02645 ath:AT3G47200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.521

Rank 1 · TkA08G158510 · TK1151

Nucleus0.452

Rank 2 · TkA08G158510 · TK1151

Cell membrane0.082

Rank 3 · TkA08G158510 · TK1151

Extracellular0.058

Rank 4 · TkA08G158510 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA08G158510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06771Desmo_N5-29 aa

PF04043PMEI6-30 aa

PF03140DUF24734-126 aa

PF03763Remorin_C60-116 aa

PF08659KR67-126 aa

PF06771Desmo_N75-129 aa

PF04043PMEI77-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G158510	`PF06771`	Desmo_N	5	29	0.1	13.5
TkA08G158510	`PF04043`	PMEI	6	30	0.0056	17.6
TkA08G158510	`PF03140`	DUF247	34	126	4.2e-19	69.9
TkA08G158510	`PF03763`	Remorin_C	60	116	0.1	13.1
TkA08G158510	`PF08659`	KR	67	126	0.32	11.6
TkA08G158510	`PF06771`	Desmo_N	75	129	0.1	13.5
TkA08G158510	`PF04043`	PMEI	77	117	0.0056	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card