RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G158410
Reference: TK1151 Chr: Chr08 Coordinates: 41239935-41245935 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4995 bp · TkA08G158410|TK1151|cDNA

TTGAGAAGCGGCCATGGCGGCTGGAGTGGGAAATCGTTGAAAACTTGTTTCTCCCTACACAGGATGGCTATGAATGTTATTCGTGTTCTTATCAAACACGAGTGTAGTGGAGGCGGTGTGCAAAAGAGACCTAATAGGATTTACTGGTGGAATTTCTGACATCTCTGATAGGGGAAAGAATGCTGCCGTCATTGATTCGACATTTTCCTTTTTTAATTTATCTGTCGGACTCATTCTTACCACCTGAACTTTTGACAGGA...

CDS

Download CDS FASTA

2880 bp · TkA08G158410|TK1151|CDS

ATGGAAAAATCCTCAAACAACAGTAACTTGGTTCCTAAAGCATTAGCCAAAGTTTATTTCCAAGAGATGATTTTTTCAGGACTCTATGTCTTACTCAGGACTATAGCTGTAGTCATTAGACCATTGTTACTCTATGCCTTTGTTGACTACTCAAATCGTGACACAGAAGATCTACATCATGGACTTATATTAGTAGGGTGCTTAATTTTACTCAAAACAATGGAGTCTTTATCTCACAGACAGTTTTTCTTTAATGCAAG...

Protein

Download Protein FASTA

959 aa · TkA08G158410|TK1151|PROTEIN

MEKSSNNSNLVPKALAKVYFQEMIFSGLYVLLRTIAVVIRPLLLYAFVDYSNRDTEDLHHGLILVGCLILLKTMESLSHRQFFFNARRTGMRMRSALMVAVYEKQLKLSVLGRRRHSTGEIVNYIAVDAYRMGDFPMWFHVGWSCFLQLVLAIGVLYSIVGLGVIPGLVPLFICGILNVPFAKAIQNSRLELMVAQDKRLRSTSEILNNMKVIKLQSWEEKFKKVIESCRETEFHWLSDIQFKKVYSTVLFWMSPTLISS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G158410
TK1151 IDTkA08G158410
OH-1004 IDLXL04_032175
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)99.700
Protein coverage (%)TK1151 97.706 / OH-1004 64.178
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G158410
LocationChr08:41239935-41245935 (-)
DescriptionSimilar to ABCC8: ABC transporter C family member 8
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g21250 Pump for glutathione S-conjugates. No verified direct reference in this release
At3g59140 Pump for glutathione S-conjugates. No verified direct reference in this release
At1g04120 Pump for glutathione S-conjugates.
The Arabidopsis thaliana ABC transporter AtMRP5 controls root development and stomata movement.2001 · DOI: 10.1093/emboj/20.8.1875
The plant multidrug resistance ABC transporter AtMRP5 is involved in guard cell hormonal signalling and water use.2003 · DOI: 10.1046/j.1365-313x.2003.016012.x
Binding of sulfonylurea by AtMRP5, an Arabidopsis multidrug resistance-related protein that functions in salt tolerance.2004 · DOI: 10.1104/pp.103.027045
The Arabidopsis ATP-binding cassette protein AtMRP5/AtABCC5 is a high affinity inositol hexakisphosphate transporter involved in guard cell signaling and phytate storage.2009 · DOI: 10.1074/jbc.m109.030247

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2XCD4 ABC transporter that may affect phytic acid transport and compartmentalization. No verified direct reference in this release
Os03g0142800 ABC transporter that may affect phytic acid transport and compartmentalization.
Mutations of the multi-drug resistance-associated protein ABC transporter gene 5 result in reduction of phytic acid in rice seeds.2009 · DOI: 10.1007/s00122-009-1018-1
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032175 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009651 response to salt stress Biological Process
GO:0030007 intracellular potassium ion homeostasis Biological Process
GO:0055085 transmembrane transport Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0048046 apoplast Cellular Component
GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference
ath:AT1G04120
ath:AT3G13080
ath:AT3G21250
ath:AT3G59140
dosa:Os03g0142800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.588
Rank 1 · TkA08G158410 · TK1151
Lysosome / Vacuole0.177
Rank 2 · TkA08G158410 · TK1151
Cytoplasm0.142
Rank 3 · TkA08G158410 · TK1151
Endoplasmic reticulum0.109
Rank 4 · TkA08G158410 · TK1151
Golgi apparatus0.067
Rank 5 · TkA08G158410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664ABC_membrane24-284 aa
PF00005ABC_tran193-227 aa
PF00005ABC_tran358-492 aa
PF13555AAA_29362-388 aa
PF02463SMC_N364-392 aa
PF03193RsgA_GTPase364-395 aa
PF20703nSTAND1364-387 aa
PF01926MMR_HSR1370-400 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G158410PF00664ABC_membrane242841.1e-40140.8
TkA08G158410PF00005ABC_tran1932274.3e-2279.9
TkA08G158410PF00005ABC_tran3584924.3e-2279.9
TkA08G158410PF13555AAA_293623880.1912.2
TkA08G158410PF02463SMC_N3643920.000221.6
TkA08G158410PF03193RsgA_GTPase3643950.06313.8
TkA08G158410PF20703nSTAND13643870.4810.7
TkA08G158410PF01926MMR_HSR13704000.03415.0
TkA08G158410PF00350Dynamin_N3713920.02115.6
TkA08G158410PF13304AAA_213723890.001319.5
TkA08G158410PF02463SMC_N4465370.000221.6
TkA08G158410PF13304AAA_214645270.001319.5
TkA08G158410PF00664ABC_membrane6719031.1e-40140.8
TkA08G158410PF17703C19orf849299560.1512.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8LGU1Arabidopsis thalianasp|Q8LGU1|AB8C_ARATH ABC transporter C family member 864.000%Swiss-ProtHigh
Q9LYS2Arabidopsis thalianasp|Q9LYS2|AB10C_ARATH ABC transporter C family member 1043.100%Swiss-ProtMedium
Q7GB25Arabidopsis thalianasp|Q7GB25|AB5C_ARATH ABC transporter C family member 541.100%Swiss-ProtMedium
A2XCD4Oryza sativa subsp. indicasp|A2XCD4|AB13C_ORYSI ABC transporter C family member 1340.500%Swiss-ProtMedium
Q10RX7Oryza sativa subsp. japonicasp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 1340.500%Swiss-ProtMedium

JBrowse

View in Genome Browser