TkA08G158160 | RubberDandelionOmics

Gene overview

TkA08G158160

Reference: TK1151 Chr: Chr08 Coordinates: 41169008-41170059 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

918 bp · TkA08G158160|TK1151|cDNA

GTTTTAGTTGAGGTACCGTCCAAATGCACCACTTGTTCTGAAAGGGATCACCTGCACGTTCAAAGAAGGGACGAGAGTAGGGATTGTTGGAAGGACAGGAAGTGGGAAGACAACACTCATAACAGCCTTATTCCGTTTGGTAGAACCTCAAAGTGGTAAAATTCTTATTGATGGATTAGACATTTGCCACATTGGTCTTAAAGATCTGAGGATGAAACTAAGTGTCATCCCTCAAGACCCAACCCTTTTTAAAGGCAGCA...

CDS

Download CDS FASTA

513 bp · TkA08G158160|TK1151|CDS

ATGAAACTAAGTGTCATCCCTCAAGACCCAACCCTTTTTAAAGGCAGCATTCGATCAAACTTGGATCCTCTTGGACTTCATTCAGACGATGACATATGGAAGGCATTAGAGAAATGTCAACTTAAAAGTACGATCCGGAATCTTCCAAATTTGTTGGATTCATCAGTGAGTGATGAAGGAGAGAATTGGAGTGCGGGACAGAGACAGTTGTTCTGTCTGGGAAGAGTGTTACTGAGAAGAAACAAAATCCTGGTACTTGA...

Protein

Download Protein FASTA

170 aa · TkA08G158160|TK1151|PROTEIN

MKLSVIPQDPTLFKGSIRSNLDPLGLHSDDDIWKALEKCQLKSTIRNLPNLLDSSVSDEGENWSAGQRQLFCLGRVLLRRNKILVLDEATASIDSATDSILQKIIREEFSNCTVITVAHRVPTVIDSDKVMVLSFGEMVEYDEPSKLLETDSFFSKLVSEYWSSCRRNSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G158160`
TK1151 ID	TkA08G158160
OH-1004 ID	LXL04_032175
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.400
Protein coverage (%)	TK1151 99.412 / OH-1004 11.575 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G158160

Location Chr08:41169008-41170059 (-)

Description Similar to ABCC8: ABC transporter C family member 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21250`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At3g13080`	Pump for glutathione S-conjugates.	An ABC-transporter of Arabidopsis thaliana has both glutathione-conjugate and chlorophyll catabolite transport activity.1998 · DOI: 10.1046/j.1365-313x.1998.00076.x
`At3g59140`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At3g62700`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At2g47800`	Involved in the regulation of stomatal aperture.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032175 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G04120

ath:AT3G13080

ath:AT3G21250

ath:AT3G59140

dosa:Os03g0142800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.715

Rank 1 · TkA08G158160 · TK1151

Nucleus0.350

Rank 2 · TkA08G158160 · TK1151

Peroxisome0.080

Rank 3 · TkA08G158160 · TK1151

Mitochondrion0.061

Rank 4 · TkA08G158160 · TK1151

Cell membrane0.055

Rank 5 · TkA08G158160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005ABC_tran2-91 aa

PF02463SMC_N62-134 aa

PF18023FKBP_N_278-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G158160	`PF00005`	ABC_tran	2	91	2e-10	42.1
TkA08G158160	`PF02463`	SMC_N	62	134	0.0002	21.6
TkA08G158160	`PF18023`	FKBP_N_2	78	119	0.0059	17.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGU1`	Arabidopsis thaliana	sp\|Q8LGU1\|AB8C_ARATH ABC transporter C family member 8	84.000%	Swiss-Prot	High
`Q9LK64`	Arabidopsis thaliana	sp\|Q9LK64\|AB3C_ARATH ABC transporter C family member 3	64.000%	Swiss-Prot	High
`Q9LYS2`	Arabidopsis thaliana	sp\|Q9LYS2\|AB10C_ARATH ABC transporter C family member 10	63.200%	Swiss-Prot	High
`Q9LZJ5`	Arabidopsis thaliana	sp\|Q9LZJ5\|AB14C_ARATH ABC transporter C family member 14	58.800%	Swiss-Prot	High
`Q7DM58`	Arabidopsis thaliana	sp\|Q7DM58\|AB4C_ARATH ABC transporter C family member 4	56.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card