TkA08G158070 | RubberDandelionOmics

Gene overview

TkA08G158070

Reference: TK1151 Chr: Chr08 Coordinates: 41130275-41134436 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2811 bp · TkA08G158070|TK1151|cDNA

GTTCTGTTCACGATTTTCATCACGAAACCCTGACGCGATCATTTTATATTCTTAAACTCTTTGTATTCCTCGTTTTGAAGATGATATGCAAACATCAATGCGATATTGTTGTCGTTGTGTTTAAATGAATCATATTATTGGATGTTTATACGCATGTTGCACCGAACTATTATTTCAACCATTTGTTGAATTTTGTTTCGATGTGTAATAAATGTAAGTGAGCTCTCTAGCTTGTTATCCAGGAACAACCAAAATTTACT...

CDS

Download CDS FASTA

1857 bp · TkA08G158070|TK1151|CDS

ATGGGGAAGGTGGAGAAGGTTATTGTTGCTGTAAAAGCATCTAAGGAAATTTCAAAGACCGCTTTGATTTGGGCGTTGACTCACGTGGTACAACCAGGGCATTTCATTACGTTGCTTGTGGTCACCCCTTCACAAACTTCTGGTAGAAAATTGTGGGGGTTTCCTAGATTTTCTGGAGACTGTGCGAGTGTTCATCGGAAGTCTATCCCAGTAACAAGTTCAGATCAGACAGTTGAAATAACTGATACTTGCTCCCAAAT...

Protein

Download Protein FASTA

618 aa · TkA08G158070|TK1151|PROTEIN

MGKVEKVIVAVKASKEISKTALIWALTHVVQPGHFITLLVVTPSQTSGRKLWGFPRFSGDCASVHRKSIPVTSSDQTVEITDTCSQMILQLHDVYDPNKVNMKIKVVSGTQSGVVATEAKKFHASWVVLDKKLKHEQKSCMEELQCNIVIMKKSQPKVLRLNLSGSPKKETKIEVGPNKGPAVTPTSSPEIFTATEPGTSSVSSSDPGTSPFSVPVTLPEESLSLTKQKNNLTESSSSDSETDHRPSSSSSLNLNKPRII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G158070`
TK1151 ID	TkA08G158070
OH-1004 ID	LXL04_002137
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	72.800
Protein coverage (%)	TK1151 98.867 / OH-1004 87.169 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G158070

Location Chr08:41130275-41134436 (-)

Description Similar to SELMODRAFT_444075: Inactive protein kinase SELMODRAFT_444075

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24550`	Proline-rich receptor-like protein kinase PERK1.	No verified direct reference in this release
`At1g23540`	Regulates the auxin-related MAX (More Axillary Growth) pathway during the shoot branching.	Over-expression of the IGI1 leading to altered shoot-branching development related to MAX pathway in Arabidopsis.2010 · DOI: 10.1007/s11103-010-9645-0
`At1g68690`	Could be involved in the negative regulation of root growth.	No verified direct reference in this release
`At5g38560`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002137 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019901 protein kinase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26150

ath:AT1G68690

ath:AT3G24550

smo:SELMODRAFT_444075

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.610

Rank 1 · TkA08G158070 · TK1151

Cytoplasm0.285

Rank 2 · TkA08G158070 · TK1151

Nucleus0.269

Rank 3 · TkA08G158070 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA08G158070 · TK1151

Golgi apparatus0.031

Rank 5 · TkA08G158070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17667Pkinase_fungal97-152 aa

PF07714PK_Tyr_Ser-Thr105-158 aa

PF00069Pkinase126-154 aa

PF00069Pkinase341-605 aa

PF07714PK_Tyr_Ser-Thr341-607 aa

PF03109ABC1343-366 aa

PF03109ABC1444-487 aa

PF17667Pkinase_fungal444-515 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G158070	`PF17667`	Pkinase_fungal	97	152	0.1	12.1
TkA08G158070	`PF07714`	PK_Tyr_Ser-Thr	105	158	1.5e-37	130.0
TkA08G158070	`PF00069`	Pkinase	126	154	1.9e-39	136.4
TkA08G158070	`PF00069`	Pkinase	341	605	1.9e-39	136.4
TkA08G158070	`PF07714`	PK_Tyr_Ser-Thr	341	607	1.5e-37	130.0
TkA08G158070	`PF03109`	ABC1	343	366	0.00035	20.5
TkA08G158070	`PF03109`	ABC1	444	487	0.00035	20.5
TkA08G158070	`PF17667`	Pkinase_fungal	444	515	0.1	12.1
TkA08G158070	`PF01636`	APH	450	488	0.0066	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV48`	Arabidopsis thaliana	sp\|Q9LV48\|PERK1_ARATH Proline-rich receptor-like protein kinase PERK1	50.800%	Swiss-Prot	Low
`Q9ZUE0`	Arabidopsis thaliana	sp\|Q9ZUE0\|PEK12_ARATH Proline-rich receptor-like protein kinase PERK12	51.000%	Swiss-Prot	Low
`Q9SX31`	Arabidopsis thaliana	sp\|Q9SX31\|PERK9_ARATH Proline-rich receptor-like protein kinase PERK9	52.600%	Swiss-Prot	Low
`Q9FFW5`	Arabidopsis thaliana	sp\|Q9FFW5\|PERK8_ARATH Proline-rich receptor-like protein kinase PERK8	49.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card