Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1414 bp · TkA08G151560|TK1151|cDNA
TTCTGTCCTTACTTTCTCTTCCTTTCCTTCCAGAGAATTGCCGTCTCTATGCATATCGCGATTCGCGAGGGAACACTCACTCAACAGAGTACACTCTCTACACTTGAGAGTTGAGAGGAGGTACGCGGTTCTTCGAAGTAGGGTTTCTTCTAACCGGTTCAAATGCACGGTGATAACGGTCAAGAGCTTCCATCGCGACCAATTCAAGCATCAACGGAGACAGACACTCCGAAGGATCATGTAATGAGCGAGATTCACCT...
1080 bp · TkA08G151560|TK1151|CDS
ATGCACGGTGATAACGGTCAAGAGCTTCCATCGCGACCAATTCAAGCATCAACGGAGACAGACACTCCGAAGGATCATGTAATGAGCGAGATTCACCTAGGCTGTCCGCCGAATTTGTCAGGATCATTCATTTCTCATTTCTCGTTTTCACTTCCTCAAGAAGTTGAGTACATTGGAAGCAAAAATGAATATCAAGCCGTTAATTCAAATCAGAACCAGGAAGTTAGCCTGGATGATGATGGAGATCTTGCTTTACCTAG...
Protein
Download Protein FASTA359 aa · TkA08G151560|TK1151|PROTEIN
MHGDNGQELPSRPIQASTETDTPKDHVMSEIHLGCPPNLSGSFISHFSFSLPQEVEYIGSKNEYQAVNSNQNQEVSLDDDGDLALPRRSKYSKDKLVVSIQHNITSSIPNVGLQVWRAELVLSDFVLHKMLTTSDFDGIMAVELGAGTGLVGMLLARVAKTVFLTDHGVEILENCARNVNINSKMLPSKDSVYVRELDWKTSWPPNQGISVSSNSYAWSLSEIKQLETASLLLAADVIYSDDLTDALFTTLERLMSHGLN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G151560 |
|---|---|
| TK1151 ID | TkA08G151560 |
| OH-1004 ID | LXL04_024688 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 31.000 |
| Protein coverage (%) | TK1151 50.696 / OH-1004 65.812Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G151560 |
|---|---|
| Location | Chr08:39522056-39529375 (-) |
| Description | Similar to mettl23: Methyltransferase-like protein 23 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0018022 peptidyl-lysine methylation Biological Process GO:0032259 methylation Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process GO:0044725 epigenetic programming in the zygotic pronuclei Biological Process GO:0044727 epigenetic programing of male pronucleus Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005813 centrosome Cellular Component GO:0005829 cytosol Cellular Component |
| KEGG gene cross-reference | hsa:124512 mmu:100504608 mmu:74319 rno:287918 xla:444818 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10294Methyltransf_16110-272 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G151560 | PF10294 | Methyltransf_16 | 110 | 272 | 1.1e-21 | 78.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.