RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G151400
Reference: TK1151 Chr: Chr08 Coordinates: 39431519-39434621 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1888 bp · TkA08G151400|TK1151|cDNA

TTTTACTGTGGCGCAAAAAATATCATGAACATATGAGTAACTCACGTCTTATTTATTTCATTTATTTTGTTGCTTGGAATTGCTAACACCCCAAAATCATCCCTCTTAGCCAACTTCAAGAACAGTTTACAAAGTGGAAGTAGAATTTTTTTTTTTTTTTTTCTGTCTGACAATAGATCAAACACCTGGAGTGCACCCATGTATTCTACCATGAAATGTGAAAATCCAATCTGCCAAATTTACAAATTCCTATCAACCAA...

CDS

Download CDS FASTA

915 bp · TkA08G151400|TK1151|CDS

ATGAGTTCTGCAGTCGAGATCAAGCAAATTTTTATTCAAAAATCCGAGAGAGTTAAATCAATCGACTTGCACCCAACTGAGCCATGGGTCTTGTTAGGTTTGTACTCGGGAAACGTTTCAATTTGGAACTTTGACACTCAAGTAATAGAGAAAACTTTTGAAACATGCAAATCACCAGTACGAACCGCAAAATTTATTGCACACAAGGAATGGATTGTTGTTGGATCCGATGATGGGTTTCTTCGTGTGTACAATTATAA...

Protein

Download Protein FASTA

304 aa · TkA08G151400|TK1151|PROTEIN

MSSAVEIKQIFIQKSERVKSIDLHPTEPWVLLGLYSGNVSIWNFDTQVIEKTFETCKSPVRTAKFIAHKEWIVVGSDDGFLRVYNYKNEESVVELKAHTDFIRSVAVHPSLPYILSASDDKLIKLWDWENGWECTKTFEGHEHYVMQVVFNPMDANVFASASLDCTIKMWNLGASSTNFSIEGHSKGLNSVSFIKTGEKLCFITGSDDYNSKVWDYETNTCLQTLEGHTNNVTSIVFVKDINYIITGSEDKTVRVWNMAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G151400
TK1151 IDTkA08G151400
OH-1004 IDLXL04_008495
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)70.500
Protein coverage (%)TK1151 68.092 / OH-1004 22.722
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G151400
LocationChr08:39431519-39434621 (-)
DescriptionSimilar to At1g52360: Coatomer subunit beta'-2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g52360 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
At1g79990 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0209100 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
Os06g0143900 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
Os02g0209000 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008495 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006886 intracellular protein transport Biological Process
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process
GO:0006891 intra-Golgi vesicle-mediated transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005829 cytosol Cellular Component
GO:0030126 COPI vesicle coat Cellular Component
GO:0005198 structural molecule activity Molecular Function
KEGG gene cross-reference
ath:AT1G52360
ath:AT1G79990
ath:AT3G15980
dosa:Os02g0209100
dosa:Os06g0143900
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.653
Rank 1 · TkA08G151400 · TK1151
Nucleus0.363
Rank 2 · TkA08G151400 · TK1151
Lysosome / Vacuole0.060
Rank 3 · TkA08G151400 · TK1151
Cell membrane0.055
Rank 4 · TkA08G151400 · TK1151
Mitochondrion0.040
Rank 5 · TkA08G151400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23383Beta-prop_IFT140_1st7-86 aa
PF25175Beta-prop_WDR58-114 aa
PF23393Beta-prop_WDR90_POC16_2nd8-27 aa
PF24807WD40_CDC20-Fz9-256 aa
PF25391WD40_Gbeta9-100 aa
PF25173Beta-prop_WDR3_1st10-154 aa
PF24817WD40_WDHD1_1st11-56 aa
PF24796WDR5512-200 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G151400PF23383Beta-prop_IFT140_1st7866.1e-0832.5
TkA08G151400PF25175Beta-prop_WDR581147.5e-57193.5
TkA08G151400PF23393Beta-prop_WDR90_POC16_2nd8271e-1661.8
TkA08G151400PF24807WD40_CDC20-Fz92565.7e-29102.1
TkA08G151400PF25391WD40_Gbeta91001.8e-2693.7
TkA08G151400PF25173Beta-prop_WDR3_1st101546.6e-53179.9
TkA08G151400PF24817WD40_WDHD1_1st11569.5e-33114.3
TkA08G151400PF24796WDR55122001e-30107.6
TkA08G151400PF23756Beta-prop_HPS512903e-0834.0
TkA08G151400PF23761Beta-prop_DCAF412601.5e-0731.4
TkA08G151400PF23409Beta-prop_EML131111.2e-1661.7
TkA08G151400PF23775Beta-prop_RIG_2nd13742.5e-1144.2
TkA08G151400PF12894ANAPC4_WD4014570.000321.7
TkA08G151400PF00400WD4015431.1e-47159.1
TkA08G151400PF25174Beta-prop_THOC3151133.8e-43148.2
TkA08G151400PF24814WD40_Prp19151334e-42144.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C827Arabidopsis thalianasp|Q9C827|COB22_ARATH Coatomer subunit beta'-271.000%Swiss-ProtMedium
Q9CAA0Arabidopsis thalianasp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-171.000%Swiss-ProtMedium
Q6H8D5Oryza sativa subsp. japonicasp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-269.600%Swiss-ProtMedium
Q5VQ78Oryza sativa subsp. japonicasp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-169.100%Swiss-ProtMedium
Q6H8D6Oryza sativa subsp. japonicasp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-364.300%Swiss-ProtMedium

JBrowse

View in Genome Browser