TkA08G146150 | RubberDandelionOmics

Gene overview

TkA08G146150

Reference: TK1151 Chr: Chr08 Coordinates: 38109332-38112248 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1448 bp · TkA08G146150|TK1151|cDNA

GTCAAAACTCGGTTAAGTTTTCAAAGAAATTGGAAGAAAAGGAAGGAAGTATACGTAGGCGCGCGTGATCAGTTAACTCCACAGAAACAGAACCTGCTAAAAGTATCAGCTGGTATCGGGTGGTTATGGCTCTCTCTCTCCCCACTCCTCCGCTGAAACTTCCGACCTCATACTCTTCATCCACCGTCAACAACCACACCGTCTCCGTCTCCGCCTCCGCAACAGGTATAAGAAACACTAGGAAGGGACTATCACTCAGA...

CDS

Download CDS FASTA

1158 bp · TkA08G146150|TK1151|CDS

ATGGCTCTCTCTCTCCCCACTCCTCCGCTGAAACTTCCGACCTCATACTCTTCATCCACCGTCAACAACCACACCGTCTCCGTCTCCGCCTCCGCAACAGGTATAAGAAACACTAGGAAGGGACTATCACTCAGACGAACATTTGTCGTAAAAGCTTCAGAAAAGGACGATGAATCCCCGTCGTTTAATCCCTTTGGTTTCGTAACGGATAATCCATCAAGCCGAAGCGCTATTCAACTTCCTGAAGCTCCTGCCGAGGA...

Protein

Download Protein FASTA

385 aa · TkA08G146150|TK1151|PROTEIN

MALSLPTPPLKLPTSYSSSTVNNHTVSVSASATGIRNTRKGLSLRRTFVVKASEKDDESPSFNPFGFVTDNPSSRSAIQLPEAPAEDGNVGQMLYRIEDKGREYGSYIKSGGFRWFVRETGSSDARLGPRGTVVFLHGAPTQSYSYRVVMSQLAEAGFHCFAPDWIGFGFSDKPQPGYGYDYTEKEYHEQLDKLLDTLEIKSPFSLVVQGFLVGSYGLTWALKNPNRISKLVIMNTPLTASSPVPGLFQQLRIPLLGEFT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G146150`
TK1151 ID	TkA08G146150
OH-1004 ID	LXL04_019068
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	35.700
Protein coverage (%)	TK1151 68.831 / OH-1004 63.793 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G146150`
Location	Chr08:38109332-38112248 (-)
Description	Similar to ceeh-1: Epoxide hydrolase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019068` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0004301 epoxide hydrolase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0016829 lyase activity Molecular Function GO:0018786 haloalkane dehalogenase activity Molecular Function
KEGG gene cross-reference	cel:CELE_K02F3.6 mbo:BQ2027_MB1864C mtc:MT1881 mtu:Rv1833c mtv:RVBD_1833c son:SO_1743 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.985

Rank 1 · TkA08G146150 · TK1151

Mitochondrion0.022

Rank 2 · TkA08G146150 · TK1151

Cytoplasm0.018

Rank 3 · TkA08G146150 · TK1151

Peroxisome0.016

Rank 4 · TkA08G146150 · TK1151

Nucleus0.015

Rank 5 · TkA08G146150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06342DUF1057128-202 aa

PF12146Hydrolase_4129-368 aa

PF00561Abhydrolase_1132-241 aa

PF12697Abhydrolase_6133-378 aa

PF03096Ndr188-242 aa

PF00561Abhydrolase_1303-372 aa

PF03096Ndr349-385 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G146150	`PF06342`	DUF1057	128	202	0.0019	18.0
TkA08G146150	`PF12146`	Hydrolase_4	129	368	3.1e-15	56.9
TkA08G146150	`PF00561`	Abhydrolase_1	132	241	1.4e-23	84.5
TkA08G146150	`PF12697`	Abhydrolase_6	133	378	7.1e-13	50.4
TkA08G146150	`PF03096`	Ndr	188	242	5.5e-05	22.7
TkA08G146150	`PF00561`	Abhydrolase_1	303	372	1.4e-23	84.5
TkA08G146150	`PF03096`	Ndr	349	385	5.5e-05	22.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card