TkA08G145190 | RubberDandelionOmics

Gene overview

TkA08G145190

Reference: TK1151 Chr: Chr08 Coordinates: 37883556-37884847 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

546 bp · TkA08G145190|TK1151|cDNA

ATGCTTCATCACTTCAGCTCCAGCGGAGCTTCATTTATTCGTAATGCCGATCTAAGATGTCATTTGCTTCATCAGGGCTTTACAGAGGTTGCTGATGAACTTGATTATAGGAACGAATTTAGACAGATGACATCGGAAAAAACTCTTTCTATAAACCTTAGTGTAAAAGCTCAGGTTGTGACCATTGAACAAGCAAGTGTTGAAGCTAAGGAATCTGCAGTACGCGAGGTTGCGAAGCTCTTGCCGCTTTCTGAGCTTTT...

CDS

Download CDS FASTA

546 bp · TkA08G145190|TK1151|CDS

ATGCTTCATCACTTCAGCTCCAGCGGAGCTTCATTTATTCGTAATGCCGATCTAAGATGTCATTTGCTTCATCAGGGCTTTACAGAGGTTGCTGATGAACTTGATTATAGGAACGAATTTAGACAGATGACATCGGAAAAAACTCTTTCTATAAACCTTAGTGTAAAAGCTCAGGTTGTGACCATTGAACAAGCAAGTGTTGAAGCTAAGGAATCTGCAGTACGCGAGGTTGCGAAGCTCTTGCCGCTTTCTGAGCTTTT...

Protein

Download Protein FASTA

181 aa · TkA08G145190|TK1151|PROTEIN

MLHHFSSSGASFIRNADLRCHLLHQGFTEVADELDYRNEFRQMTSEKTLSINLSVKAQVVTIEQASVEAKESAVREVAKLLPLSELLLSISSIKAEMSIKLTYFFTLNRATDAQLSTMVAEQVEQAQAGLKALGSSEENVNQLRQNFVNIERLCQECQTLIENHDQIKLLSVGPVNPNTCV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G145190`
TK1151 ID	TkA08G145190
OH-1004 ID	LXL04_003474
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 98.895 / OH-1004 46.134 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G145190

Location Chr08:37883556-37884847 (+)

Description Similar to SEC6: Exocyst complex component SEC6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71820`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	The Arabidopsis exocyst complex is involved in cytokinesis and cell plate maturation.2010 · DOI: 10.1105/tpc.110.074351 Visualization of the exocyst complex dynamics at the plasma membrane of Arabidopsis thaliana.2013 · DOI: 10.1091/mbc.e12-06-0492 Regulation of cytokinesis by exocyst subunit SEC6 and KEULE in Arabidopsis thaliana.2013 · DOI: 10.1093/mp/sst082

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003474 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006101 citrate metabolic process Biological Process

GO:0006887 exocytosis Biological Process

GO:0051601 exocyst localization Biological Process

GO:0060321 acceptance of pollen Biological Process

GO:0000145 exocyst Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G71820

ath:AT2G44350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.481

Rank 1 · TkA08G145190 · TK1151

Nucleus0.479

Rank 2 · TkA08G145190 · TK1151

Mitochondrion0.119

Rank 3 · TkA08G145190 · TK1151

Cell membrane0.045

Rank 4 · TkA08G145190 · TK1151

Golgi apparatus0.037

Rank 5 · TkA08G145190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13373Dsc3_C22-53 aa

PF24611Spectrin_Anc-134-98 aa

PF03908Sec2066-66 aa

PF10955Fin113-166 aa

PF03908Sec20116-163 aa

PF24611Spectrin_Anc-1121-171 aa

PF13373Dsc3_C130-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G145190	`PF13373`	Dsc3_C	22	53	0.016	16.1
TkA08G145190	`PF24611`	Spectrin_Anc-1	34	98	0.44	11.6
TkA08G145190	`PF03908`	Sec20	66	66	0.056	14.1
TkA08G145190	`PF10955`	Fin	113	166	0.097	13.7
TkA08G145190	`PF03908`	Sec20	116	163	0.056	14.1
TkA08G145190	`PF24611`	Spectrin_Anc-1	121	171	0.44	11.6
TkA08G145190	`PF13373`	Dsc3_C	130	159	0.016	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AI6`	Arabidopsis thaliana	sp\|Q94AI6\|SEC6_ARATH Exocyst complex component SEC6	65.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card