TkA08G142540 | RubberDandelionOmics

Gene overview

TkA08G142540

Reference: TK1151 Chr: Chr08 Coordinates: 37150126-37151173 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · TkA08G142540|TK1151|cDNA

ATGTTAGAGCTTCAACGGGAAAATCACATCGAGTACCTCATGAAAGGTCTTCGGCAGCTCGGTCCTTCGTTTTCTGTCTTAGATGCCAATCGGCCATGGATTTGCTATTGGATCCTACATTCACTTGCTGTATTAGGAGAGTCTGTTGATGAAGATTTGGAAAATAACGCCATTGACTTTATAAGCCGTTGCCAGGATCAACATGGTGGATATGGTGGAGGACCTGGGCAGATGACACATCTTGCAACAACTTATGCTTC...

CDS

Download CDS FASTA

405 bp · TkA08G142540|TK1151|CDS

ATGTTAGAGCTTCAACGGGAAAATCACATCGAGTACCTCATGAAAGGTCTTCGGCAGCTCGGTCCTTCGTTTTCTGTCTTAGATGCCAATCGGCCATGGATTTGCTATTGGATCCTACATTCACTTGCTGTATTAGGAGAGTCTGTTGATGAAGATTTGGAAAATAACGCCATTGACTTTATAAGCCGTTGCCAGGATCAACATGGTGGATATGGTGGAGGACCTGGGCAGATGACACATCTTGCAACAACTTATGCTTC...

Protein

Download Protein FASTA

134 aa · TkA08G142540|TK1151|PROTEIN

MLELQRENHIEYLMKGLRQLGPSFSVLDANRPWICYWILHSLAVLGESVDEDLENNAIDFISRCQDQHGGYGGGPGQMTHLATTYASVNSLITLAGHKSLSSINRGKIYSFLQRMKHTRILINLFPNLYPNFIN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G142540`
TK1151 ID	TkA08G142540
OH-1004 ID	LXL04_003181
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	85.200
Protein coverage (%)	TK1151 60.448 / OH-1004 31.765 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G142540

Location Chr08:37150126-37151173 (-)

Description Similar to FTB: Protein farnesyltransferase subunit beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40280`	Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic- aliphatic-X (CaaX).	The CaaX specificities of Arabidopsis protein prenyltransferases explain era1 and ggb phenotypes.2010 · DOI: 10.1186/1471-2229-10-118 ASG2 is a farnesylated DWD protein that acts as ABA negative regulator in Arabidopsis.2016 · DOI: 10.1111/pce.12605

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003181 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009620 response to fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0018342 protein prenylation Biological Process

GO:0018343 protein farnesylation Biological Process

GO:0045787 positive regulation of cell cycle Biological Process

GO:0047484 regulation of response to osmotic stress Biological Process

KEGG gene cross-reference

ath:AT5G40280

bta:327686

mgr:MGG_01287

mmu:110606

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.576

Rank 1 · TkA08G142540 · TK1151

Nucleus0.278

Rank 2 · TkA08G142540 · TK1151

Mitochondrion0.161

Rank 3 · TkA08G142540 · TK1151

Peroxisome0.119

Rank 4 · TkA08G142540 · TK1151

Endoplasmic reticulum0.061

Rank 5 · TkA08G142540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00432Prenyltrans4-118 aa

PF13243SQHop_cyclase_C7-73 aa

PF13249SQHop_cyclase_N27-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G142540	`PF00432`	Prenyltrans	4	118	3.4e-31	109.5
TkA08G142540	`PF13243`	SQHop_cyclase_C	7	73	0.009	15.8
TkA08G142540	`PF13249`	SQHop_cyclase_N	27	85	0.24	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38920`	Arabidopsis thaliana	sp\|Q38920\|FNTB_ARATH Protein farnesyltransferase subunit beta	70.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card