TkA08G140010 | RubberDandelionOmics

Gene overview

TkA08G140010

Reference: TK1151 Chr: Chr08 Coordinates: 36405036-36406537 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1183 bp · TkA08G140010|TK1151|cDNA

CTAGTTACCCAGCGTACGTGCATTGCTCCATACTTCAGCCTGATCCGGTTAAAGTCCAGTCACATTTTCTCCGATCTGTTCCAATTTCAGTTCTTTATAAAGATGCTTAAAATCCCAGAACATCAAGTTGCCGGACACCATGCAAGTAATGGAACCCTTGGTCCCCTCATAGATGATTCAGGTCGTTTTTACAAGCCACTTCAAGGCGACGAACGTGGGTCCGCCGAAGCATCTTTCTACAAAGAATTTTCTTCCAACAC...

CDS

Download CDS FASTA

975 bp · TkA08G140010|TK1151|CDS

CTAGTTACCCAGCGTACGTGCATTGCTCCATACTTCAGCCTGATCCGGTTAAAGTCCAGTCACATTTTCTCCGATCTGTTCCAATTTCAGTTCTTTATAAAGATGCTTAAAATCCCAGAACATCAAGTTGCCGGACACCATGCAAGTAATGGAACCCTTGGTCCCCTCATAGATGATTCAGGTCGTTTTTACAAGCCACTTCAAGGCGACGAACGTGGGTCCGCCGAAGCATCTTTCTACAAAGAATTTTCTTCCAACAC...

Protein

Download Protein FASTA

324 aa · TkA08G140010|TK1151|PROTEIN

LVTQRTCIAPYFSLIRLKSSHIFSDLFQFQFFIKMLKIPEHQVAGHHASNGTLGPLIDDSGRFYKPLQGDERGSAEASFYKEFSSNTQIPDHIRKFFPIFYGTQVMTASDGSEHPHIVLQDITSSRVNPTIMDIKIGSRTFGHEASDAYIAKCLKRDRETTSLQLGFRISGLQVYFSDEEGFYKPSRDVVLKSSVDDVRYLFKRFVSSNPAAVPPDQELDATLASNVYGGTDGILAQLLELKAWFEDQTMYHFCACSLLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G140010`
TK1151 ID	TkA08G140010
OH-1004 ID	LXL04_009258
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	66.300
Protein coverage (%)	TK1151 83.333 / OH-1004 56.568 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G140010

Location Chr08:36405036-36406537 (+)

Description Similar to IPK2a: Inositol polyphosphate multikinase alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61760`	Inositol phosphate kinase with a broad substrate specificity.	No verified direct reference in this release
`At5g07370`	Inositol phosphate kinase with a broad substrate specificity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X5H5`	Inositol phosphate kinase with a broad substrate specificity.	No verified direct reference in this release
`Os02g0523800`	Inositol phosphate kinase with a broad substrate specificity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009258 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009749 response to glucose Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010264 myo-inositol hexakisphosphate biosynthetic process Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0032958 inositol phosphate biosynthetic process Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT5G07370

ath:AT5G61750

ath:AT5G61760

dosa:Os02g0523800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.608

Rank 1 · TkA08G140010 · TK1151

Nucleus0.375

Rank 2 · TkA08G140010 · TK1151

Cell membrane0.103

Rank 3 · TkA08G140010 · TK1151

Endoplasmic reticulum0.086

Rank 4 · TkA08G140010 · TK1151

Mitochondrion0.081

Rank 5 · TkA08G140010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03770IPK79-97 aa

PF03770IPK116-307 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G140010	`PF03770`	IPK	79	97	1.8e-45	155.9
TkA08G140010	`PF03770`	IPK	116	307	1.8e-45	155.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLT2`	Arabidopsis thaliana	sp\|Q9FLT2\|IPMKB_ARATH Inositol polyphosphate multikinase beta	54.000%	Swiss-Prot	High
`Q9LY23`	Arabidopsis thaliana	sp\|Q9LY23\|IPMKA_ARATH Inositol polyphosphate multikinase alpha	51.900%	Swiss-Prot	High
`A2X5H5`	Oryza sativa subsp. indica	sp\|A2X5H5\|IPK2_ORYSI Inositol polyphosphate multikinase IPK2	46.700%	Swiss-Prot	Medium
`Q6H545`	Oryza sativa subsp. japonica	sp\|Q6H545\|IPK2_ORYSJ Inositol polyphosphate multikinase IPK2	46.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card