TkA08G134300 | RubberDandelionOmics

Gene overview

TkA08G134300

Reference: TK1151 Chr: Chr08 Coordinates: 34925681-34928802 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2448 bp · TkA08G134300|TK1151|cDNA

TGATAATCAACTTATAAAAAATGAAAGAAAAATCATATTGTTATATATTTGACAAAATTAAGTAACTTCCTTAAATAAACAAGTTGTTATAATCTTATACGGTGAAGTAGAATATTATTTCCGTCGAGTTCCTCCGCCGCTTCTGGTTCTCTCTAACGACTCCCTCCGCCTTCTTCACGTCTTCAACCTCTTTACATCTATACAACCATTCACGCATACATTTTCCCATTGATCTCTATCTCAAAAACCTTTGGTTCATT...

CDS

Download CDS FASTA

1800 bp · TkA08G134300|TK1151|CDS

ATGGCATTGGAATCGTCTTCAGAGTACGAAGCGGACGATTCCGATGCTGACTTCGTTGAGATCGATCCCTCCGGTCGTTATGGACGGTACAAGGAAGTGTTAGGAAAGGGGGCTTGCAAAAAGGTATACAGAGCATTTGACGAATTGGAAGGAATTGAAGTAGCTTGGAATCAAATAAGGATTTCCGATTTCTTACGGAACCCTGAGGAATTAGAACGTCTATACTCTGAAGTTCATTTGCTCAAAACACTTAGACACAA...

Protein

Download Protein FASTA

599 aa · TkA08G134300|TK1151|PROTEIN

MALESSSEYEADDSDADFVEIDPSGRYGRYKEVLGKGACKKVYRAFDELEGIEVAWNQIRISDFLRNPEELERLYSEVHLLKTLRHKNIIKFYNSWVDTKNDHVNFITEIFTSGTLRQYRKKHKHVDLRALKKWSKQILEGLVYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAAILRQARSAHSVIGTPEFMAPELYEEDYNELVDIYAFGMCLLELVTFEYPYVECTNAAQIYKKVTSGVRPASLATVKDPEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G134300`
TK1151 ID	TkA08G134300
OH-1004 ID	LXL04_031887
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G134300

Location Chr08:34925681-34928802 (-)

Description Similar to WNK3: Probable serine/threonine-protein kinase WNK3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48260`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At3g04910`	Regulates flowering time by modulating the photoperiod pathway.	The APRR3 component of the clock-associated APRR1/TOC1 quintet is phosphorylated by a novel protein kinase belonging to the WNK family, the gene for which is also transcribed rhythmically in Arabidopsis thaliana.2002 · DOI: 10.1093/pcp/pcf084 Compilation and characterization of a novel WNK family of protein kinases in Arabiodpsis thaliana with reference to circadian rhythms.2002 · DOI: 10.1271/bbb.66.2429 The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x
`At3g22420`	Regulates flowering time by modulating the photoperiod pathway.	The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0108300`	Probable serine/threonine-protein kinase WNK2.	No verified direct reference in this release
`UniProt: A2YMV6`	Probable serine/threonine-protein kinase WNK1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031887 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G22420

ath:AT3G48260

dosa:Os05g0108300

dosa:Os07g0572800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.514

Rank 1 · TkA08G134300 · TK1151

Nucleus0.396

Rank 2 · TkA08G134300 · TK1151

Cell membrane0.197

Rank 3 · TkA08G134300 · TK1151

Golgi apparatus0.061

Rank 4 · TkA08G134300 · TK1151

Endoplasmic reticulum0.059

Rank 5 · TkA08G134300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase31-285 aa

PF07714PK_Tyr_Ser-Thr31-280 aa

PF25571TPR_CCP1_N70-127 aa

PF01636APH117-171 aa

PF27815C24B10_03287-300 aa

PF12202OSR1_C340-394 aa

PF24889CCTL2_WNK352-391 aa

PF22966INTS7_C_plants478-541 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G134300	`PF00069`	Pkinase	31	285	1.7e-50	172.6
TkA08G134300	`PF07714`	PK_Tyr_Ser-Thr	31	280	7.7e-34	117.9
TkA08G134300	`PF25571`	TPR_CCP1_N	70	127	3.0	7.5
TkA08G134300	`PF01636`	APH	117	171	0.31	11.5
TkA08G134300	`PF27815`	C24B10_03	287	300	2.0	9.9
TkA08G134300	`PF12202`	OSR1_C	340	394	2e-06	28.5
TkA08G134300	`PF24889`	CCTL2_WNK	352	391	0.0012	19.4
TkA08G134300	`PF22966`	INTS7_C_plants	478	541	0.078	13.3
TkA08G134300	`PF27815`	C24B10_03	481	559	2.0	9.9
TkA08G134300	`PF25571`	TPR_CCP1_N	483	549	3.0	7.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STK6`	Arabidopsis thaliana	sp\|Q9STK6\|WNK3_ARATH Probable serine/threonine-protein kinase WNK3	58.300%	Swiss-Prot	High
`Q9CAV6`	Arabidopsis thaliana	sp\|Q9CAV6\|WNK1_ARATH Serine/threonine-protein kinase WNK1	55.300%	Swiss-Prot	Medium
`Q8S8Y9`	Arabidopsis thaliana	sp\|Q8S8Y9\|WNK2_ARATH Serine/threonine-protein kinase WNK2	58.200%	Swiss-Prot	Medium
`Q65X23`	Oryza sativa subsp. japonica	sp\|Q65X23\|WNK2_ORYSJ Probable serine/threonine-protein kinase WNK2	51.800%	Swiss-Prot	High
`A2YMV6`	Oryza sativa subsp. indica	sp\|A2YMV6\|WNK1_ORYSI Probable serine/threonine-protein kinase WNK1	55.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card