TkA08G133920 | RubberDandelionOmics

Gene overview

TkA08G133920

Reference: TK1151 Chr: Chr08 Coordinates: 34814576-34817513 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1201 bp · TkA08G133920|TK1151|cDNA

ATAACCTTTTGCAAGCATCCAATTAATTTGCAGCAGGGCTCTCTCTCACCCATCAAATTAGGGTTTCAGTACCTCTATAGGTTGAAGTCCCAAGAAAACCTTGAAGTTTTGGGAAAGAAGTCTTGAATTGATGGCACGTAAATAAGGAAAAACCAAAGAATTCAACAATAAACAAAAAGGATTACGACCCAGGTTCTCTAGAAGGGAACTCCAAACTACAAGTCAAACAGATCTAAGCTAAAATAAGAGGTATATGTATA...

CDS

Download CDS FASTA

567 bp · TkA08G133920|TK1151|CDS

ATGGCATCATCAAGCTCTTGTAACTCTCCTTGTGCTGCCTGCAAGTTCCTGAGGAGAAAATGCATGCCTGGCTGCACCTTCGCACCTTACTTTCCACCTGAAAATCCACAGAAATTCGTAAATGTTCACAGACTATTTGGCGCCAGCAACGTTACGAAGCTTCTGAACGAAGTATTACCGCATCAGAGAGAAGATGTGGTGAATTCTCTCGCTTATGAAGCCGAAGCGCGGGTAAGAGATCCAATTTACGGCAGTGTAGG...

Protein

Download Protein FASTA

188 aa · TkA08G133920|TK1151|PROTEIN

MASSSSCNSPCAACKFLRRKCMPGCTFAPYFPPENPQKFVNVHRLFGASNVTKLLNEVLPHQREDVVNSLAYEAEARVRDPIYGSVGVIAVLQRQIDTLQRDLDAANADLIRFGCNPMPVMPNLSSILPVAQRRRSMDHFSVKRSIGGNGGGGLYPPPPFFPVPYSRGSMSGGGGGGAGDGVGGGGNM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G133920`
TK1151 ID	TkA08G133920
OH-1004 ID	LXL04_030732
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.900
Protein coverage (%)	TK1151 87.234 / OH-1004 34.664 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G133920

Location Chr08:34814576-34817513 (-)

Description Similar to LOB: Protein LATERAL ORGAN BOUNDARIES

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63090`	Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.	No verified direct reference in this release
`At3g27650`	LOB domain-containing protein 25.	No verified direct reference in this release
`At1g65620`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WXT0`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release
`Os01g0889400`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030732 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009799 specification of symmetry Biological Process

GO:0009943 adaxial/abaxial axis specification Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0009954 proximal/distal pattern formation Biological Process

GO:0010199 organ boundary specification between lateral organs and the meristem Biological Process

GO:0048441 petal development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G65620

ath:AT3G27650

ath:AT5G63090

dosa:Os01g0889400

zma:732739

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkA08G133920 · TK1151

Cytoplasm0.103

Rank 2 · TkA08G133920 · TK1151

Cell membrane0.023

Rank 3 · TkA08G133920 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA08G133920 · TK1151

Plastid0.012

Rank 5 · TkA08G133920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195LOB10-107 aa

PF30854Par-4_C88-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G133920	`PF03195`	LOB	10	107	1.7e-39	135.0
TkA08G133920	`PF30854`	Par-4_C	88	110	0.27	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FML4`	Arabidopsis thaliana	sp\|Q9FML4\|LOB_ARATH Protein LATERAL ORGAN BOUNDARIES	79.500%	Swiss-Prot	Medium
`Q8L8Q3`	Arabidopsis thaliana	sp\|Q8L8Q3\|LBD25_ARATH LOB domain-containing protein 25	73.400%	Swiss-Prot	Medium
`O04479`	Arabidopsis thaliana	sp\|O04479\|AS2_ARATH Protein ASYMMETRIC LEAVES 2	70.000%	Swiss-Prot	Medium
`A2WXT0`	Oryza sativa subsp. indica	sp\|A2WXT0\|LBD6_ORYSI LOB domain-containing protein 6	69.500%	Swiss-Prot	Medium
`Q8LQH4`	Oryza sativa subsp. japonica	sp\|Q8LQH4\|LBD6_ORYSJ LOB domain-containing protein 6	69.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card