TkA08G133740 | RubberDandelionOmics

Gene overview

TkA08G133740

Reference: TK1151 Chr: Chr08 Coordinates: 34758048-34760921 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1426 bp · TkA08G133740|TK1151|cDNA

AAAAAATGTTGTTTACCAATTCCTCGAACTATCAACTATTGCCCGCCCCAAAATTGCAGTGCAAACACCTAAAACATATCAGAGTGGGGGTGCTCGCGTTTATGTACCTGCTATCACTCTCAGTCTCTCACACCCTCGCCCCTGAAGCAACCGAATTTCAAATCCAGTCAAGTTTAGGGTTTAATTAGCGTCAATGGCATCTCATTCTAATATCGACGACGATGATGATTTCGGCGGTGATTTCCCCGGAGCCAACCCTA...

CDS

Download CDS FASTA

1044 bp · TkA08G133740|TK1151|CDS

ATGGCATCTCATTCTAATATCGACGACGATGATGATTTCGGCGGTGATTTCCCCGGAGCCAACCCTACGAGGGTCTCAGGAACTAAGAGGGGATTTGGGGATCTTGATGATGATGAAGATGATATATTTGGCTCCAAAAAGGCTAACATAAAAGTAGAAGAAACTGCACCAGGTGTAGCAACTGGGATGATTTTATCCCTTCGTGAAAGTCTCCAAAGCTGTAAGGATACTCTTGCAACGTGCCAATCAGAGCTTGAAGA...

Protein

Download Protein FASTA

347 aa · TkA08G133740|TK1151|PROTEIN

MASHSNIDDDDDFGGDFPGANPTRVSGTKRGFGDLDDDEDDIFGSKKANIKVEETAPGVATGMILSLRESLQSCKDTLATCQSELEDAKLEVQKWHSAFQKESFIPPGSSVEPRIVINYLQNLKSSEESVREQLEKSKKKEAAFIVTIAKREQEIADLKSAVRDLRSQLKPLSMQARRLLLDPAIHEEFMRLKNLVEEKDKKVKELQDNVAAVNFTPQSKMGKMLMAKCRTLQEENEEIGNQAKEGKIHELSMKLALQKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G133740`
TK1151 ID	TkA08G133740
OH-1004 ID	LXL04_031877
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 97.695 / OH-1004 97.135 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G133740

Location Chr08:34758048-34760921 (+)

Description Similar to FIP37: FKBP12-interacting protein of 37 kDa

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54170`	Probable regulatory subunit of the N6-methyltransferase complex, a multiprotein complex that mediates N6-methyladenosine (m6A) methylation at the 5'-[AG]GAC-3' consensus sites of some mRNAs.	The immunophilin-interacting protein AtFIP37 from Arabidopsis is essential for plant development and is involved in trichome endoreduplication.2004 · DOI: 10.1104/pp.103.028050

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031877 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0001510 RNA methylation Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009637 response to blue light Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0016556 mRNA modification Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016607 nuclear speck Cellular Component

KEGG gene cross-reference

ath:AT3G54170

hsa:9589

mmu:60532

xla:734639

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.840

Rank 1 · TkA08G133740 · TK1151

Cytoplasm0.249

Rank 2 · TkA08G133740 · TK1151

Mitochondrion0.027

Rank 3 · TkA08G133740 · TK1151

Cell membrane0.025

Rank 4 · TkA08G133740 · TK1151

Golgi apparatus0.019

Rank 5 · TkA08G133740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24161CCDC3961-323 aa

PF14362DUF440762-168 aa

PF06103DUF94863-94 aa

PF10167BORCS864-95 aa

PF25366RUFY464-102 aa

PF04977DivIC64-96 aa

PF27954CCDC19265-88 aa

PF18504Csm1_N66-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G133740	`PF24161`	CCDC39	61	323	0.0017	17.0
TkA08G133740	`PF14362`	DUF4407	62	168	0.39	10.7
TkA08G133740	`PF06103`	DUF948	63	94	0.054	14.4
TkA08G133740	`PF10167`	BORCS8	64	95	0.25	12.0
TkA08G133740	`PF25366`	RUFY4	64	102	0.7	11.0
TkA08G133740	`PF04977`	DivIC	64	96	1.1	9.8
TkA08G133740	`PF27954`	CCDC192	65	88	2.4e-06	28.0
TkA08G133740	`PF18504`	Csm1_N	66	88	0.056	14.5
TkA08G133740	`PF28907`	ZapB_rel	66	89	0.098	14.0
TkA08G133740	`PF29057`	SYN8_N	66	96	8.6	7.6
TkA08G133740	`PF06818`	Fez1	67	170	0.073	14.3
TkA08G133740	`PF20570`	DUF6779	67	80	0.87	11.0
TkA08G133740	`PF29075`	NOCA1_mid	67	92	1.3	9.5
TkA08G133740	`PF05377`	FlaC_arch	67	94	5.7	8.2
TkA08G133740	`PF27241`	CLIP1	68	173	0.054	14.3
TkA08G133740	`PF30842`	LEKR1	68	97	0.24	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSZ8`	Arabidopsis thaliana	sp\|Q9ZSZ8\|FIP37_ARATH FKBP12-interacting protein of 37 kDa	69.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card