TkA08G132660 | RubberDandelionOmics

Gene overview

TkA08G132660

Reference: TK1151 Chr: Chr08 Coordinates: 34463195-34469011 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1658 bp · TkA08G132660|TK1151|cDNA

TTAACCTTTTAGCCCAAAGCATATTCCCCAGCTTTCTATATGCTCAGCTTTGATCGTCAATTCTTGGGAATTTCAGTCTCGATAAACTTTGTTCTAGCTCGATTGTCTTCCAATTCACTGATTCATTTCTTAGATTCACTTCTTTATACCTACAAATGAGACTTTTCATTCGATTTTTGGCACTGAAGCCTAGGTCTTGCCGCTAAATTATCTTCTTCCATGGCGATCAGAGGCGTACACTTCAAGTGGTACGATGGATT...

CDS

Download CDS FASTA

1221 bp · TkA08G132660|TK1151|CDS

ATGGCGATCAGAGGCGTACACTTCAAGTGGTACGATGGATTCTTTCTAATAATGCTTGCGTTTAGTATAGTTATGGTTCTATTGAGTTGGAGGCGTTACTATCTTTGTAAATTTCCATTGCATCTGTGGATAGTGGTTGATTATAGTGCTGTGTTTGTTTTTCGCCTCTTAATGTTTGTAGATAATGGTCTTGCAGCTGGAATGGGACTGGATTATGGTAGGCGGCAAAGAGATGTTTGTTTTTATGGAAGAGTAGTAGT...

Protein

Download Protein FASTA

406 aa · TkA08G132660|TK1151|PROTEIN

MAIRGVHFKWYDGFFLIMLAFSIVMVLLSWRRYYLCKFPLHLWIVVDYSAVFVFRLLMFVDNGLAAGMGLDYGRRQRDVCFYGRVVVLSILYVVLYPFLWAWSVTGSIWFSYAHACLPEKNQKWGFLVWLIFSYCGLVCLAVYSVNKWLRRRKAHFERVQQGIPISGISEYGVLVDMIRLPDWVFESAAQEMRVMENDATPHHPGLYLSDAQRQAVEILVQELPLFSLKAVPTDCSDCPICLEEFHVEDEVRGLPCAHNF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G132660`
TK1151 ID	TkA08G132660
OH-1004 ID	LXL04_031851
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 92.365 / OH-1004 87.007 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G132660

Location Chr08:34463195-34469011 (+)

Description Similar to SIS3: E3 ubiquitin-protein ligase SIS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47990`	E3 ubiquitin protein ligase that acts as a positive regulator of sugar signaling during early seedling development.	SUGAR-INSENSITIVE3, a RING E3 ligase, is a new player in plant sugar response.2010 · DOI: 10.1104/pp.109.150573

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031851 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0043409 negative regulation of MAPK cascade Biological Process

GO:0071466 cellular response to xenobiotic stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G18650

ath:AT3G03550

ath:AT3G47990

ath:AT5G57750

mmu:67702

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.292

Rank 1 · TkA08G132660 · TK1151

Endoplasmic reticulum0.278

Rank 2 · TkA08G132660 · TK1151

Cytoplasm0.219

Rank 3 · TkA08G132660 · TK1151

Golgi apparatus0.197

Rank 4 · TkA08G132660 · TK1151

Cell membrane0.196

Rank 5 · TkA08G132660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26753SIS3_N11-161 aa

PF11674DUF327014-29 aa

PF11674DUF327074-114 aa

PF07114TMEM12676-128 aa

PF03756AfsA173-220 aa

PF13639zf-RING_2237-279 aa

PF17123zf-RING_11237-265 aa

PF14634zf-RING_5237-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G132660	`PF26753`	SIS3_N	11	161	2e-64	216.8
TkA08G132660	`PF11674`	DUF3270	14	29	0.092	13.5
TkA08G132660	`PF11674`	DUF3270	74	114	0.092	13.5
TkA08G132660	`PF07114`	TMEM126	76	128	0.025	14.7
TkA08G132660	`PF03756`	AfsA	173	220	0.038	14.4
TkA08G132660	`PF13639`	zf-RING_2	237	279	2.4e-14	54.0
TkA08G132660	`PF17123`	zf-RING_11	237	265	8.5e-10	38.9
TkA08G132660	`PF14634`	zf-RING_5	237	279	0.0002	22.0
TkA08G132660	`PF13920`	zf-C3HC4_3	237	281	1.0	9.9
TkA08G132660	`PF13445`	zf-RING_UBOX	238	276	4.3e-08	33.7
TkA08G132660	`PF00097`	zf-C3HC4	238	278	1.2e-07	32.2
TkA08G132660	`PF13923`	zf-C3HC4_2	238	278	1.4e-07	31.9
TkA08G132660	`PF12861`	zf-ANAPC11	251	281	0.0034	18.1
TkA08G132660	`PF12678`	zf-rbx1	253	279	2.3e-05	25.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYT9`	Arabidopsis thaliana	sp\|Q8GYT9\|SIS3_ARATH E3 ubiquitin-protein ligase SIS3	60.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card