TkA08G131400 | RubberDandelionOmics

Gene overview

TkA08G131400

Reference: TK1151 Chr: Chr08 Coordinates: 34107869-34109351 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1295 bp · TkA08G131400|TK1151|cDNA

CCAGAAACTCTTTAGTATATGCAATATTTACTATTTCCAAAAAAACAAATACCCATCCTCAAATCAACTAAAATATGTTGTGAGGCCCAAAATTTTCTCACCACATATTTGTTTTCTATCCTTCATCCCAAATATCTTCGATCATCAGCCAGACTGCCACATTACAGAATCCATGGGATTACCCTCCGCCATCTTCATGGCTTCAGCTGTAACAAGCTCCAATTTTCTTCTCAGTCCTCCGCATCCACGCTTCTCACTGC...

CDS

Download CDS FASTA

1092 bp · TkA08G131400|TK1151|CDS

ATGCAATATTTACTATTTCCAAAAAAACAAATACCCATCCTCAAATCAACTAAAATATGTTGTGAGGCCCAAAATTTTCTCACCACATATTTGTTTTCTATCCTTCATCCCAAATATCTTCGATCATCAGCCAGACTGCCACATTACAGAATCCATGGGATTACCCTCCGCCATCTTCATGGCTTCAGCTGTAACAAGCTCCAATTTTCTTCTCAGTCCTCCGCATCCACGCTTCTCACTGCACCTTTCCTTCTCTTTAT...

Protein

Download Protein FASTA

363 aa · TkA08G131400|TK1151|PROTEIN

MQYLLFPKKQIPILKSTKICCEAQNFLTTYLFSILHPKYLRSSARLPHYRIHGITLRHLHGFSCNKLQFSSQSSASTLLTAPFLLFIVQKICNLRLNHQRRSSLRTYRCRRVCCSQVQVEEGTDEEACELVNGAEVSIGEGSDSVPAYLLSAVKNNNGTGILLLSDVFGFEDSCTRDFAYRIACNGYNVLLPDLFNGDPWGKERPKSQFEQWRETHNQSASKNIATSIKWMVDEFVAAGISKKLGIVGFCFGGGKVIEVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G131400`
TK1151 ID	TkA08G131400
OH-1004 ID	LXL04_031823
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G131400`
Location	Chr08:34107869-34109351 (+)
Description	Similar to CMBL: Carboxymethylenebutenolidase homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031823` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006805 xenobiotic metabolic process Biological Process GO:0005829 cytosol Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0016787 hydrolase activity Molecular Function
KEGG gene cross-reference	hsa:134147 mmu:69574 pon:100172338 rno:310201 xtr:394496 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.974

Rank 1 · TkA08G131400 · TK1151

Mitochondrion0.037

Rank 2 · TkA08G131400 · TK1151

Cytoplasm0.027

Rank 3 · TkA08G131400 · TK1151

Nucleus0.023

Rank 4 · TkA08G131400 · TK1151

Peroxisome0.017

Rank 5 · TkA08G131400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03959FSH159-75 aa

PF01738DLH147-356 aa

PF00561Abhydrolase_1180-256 aa

PF03959FSH1208-324 aa

PF00326Peptidase_S9209-273 aa

PF03403PAF-AH_p_II242-328 aa

PF08386Abhydrolase_4278-332 aa

PF00561Abhydrolase_1281-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G131400	`PF03959`	FSH1	59	75	0.38	11.1
TkA08G131400	`PF01738`	DLH	147	356	1.3e-27	97.5
TkA08G131400	`PF00561`	Abhydrolase_1	180	256	3.3e-05	24.4
TkA08G131400	`PF03959`	FSH1	208	324	0.38	11.1
TkA08G131400	`PF00326`	Peptidase_S9	209	273	0.0062	16.8
TkA08G131400	`PF03403`	PAF-AH_p_II	242	328	0.17	11.1
TkA08G131400	`PF08386`	Abhydrolase_4	278	332	0.00039	21.2
TkA08G131400	`PF00561`	Abhydrolase_1	281	329	3.3e-05	24.4
TkA08G131400	`PF00326`	Peptidase_S9	283	347	0.0062	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card