TkA08G130790 | RubberDandelionOmics

Gene overview

TkA08G130790

Reference: TK1151 Chr: Chr08 Coordinates: 33934070-33934591 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · TkA08G130790|TK1151|cDNA

ATGTGGGCGACGCTCAACCACGGCGGTCGGACGGTATTCCTGGAAGAAGACAAGTCATGGATCCAGCAAATCCAGTCGAAATTCCCGACATTGGAGTCGTACCACGTCGTGTACGACACAAAGGTGGCGCGTGCGGCGGAGCTGATGGCGATGGGGAAGAGAGAGGAGTGTAATGTGGTCGGAGATCCGAGGGTCTCCGGGTGCGAGCTGGCGCTGAAAGGGAACTTGCCGGCGGAGATTTATGAAGTGGAATGGGATTT...

CDS

Download CDS FASTA

522 bp · TkA08G130790|TK1151|CDS

ATGTGGGCGACGCTCAACCACGGCGGTCGGACGGTATTCCTGGAAGAAGACAAGTCATGGATCCAGCAAATCCAGTCGAAATTCCCGACATTGGAGTCGTACCACGTCGTGTACGACACAAAGGTGGCGCGTGCGGCGGAGCTGATGGCGATGGGGAAGAGAGAGGAGTGTAATGTGGTCGGAGATCCGAGGGTCTCCGGGTGCGAGCTGGCGCTGAAAGGGAACTTGCCGGCGGAGATTTATGAAGTGGAATGGGATTT...

Protein

Download Protein FASTA

173 aa · TkA08G130790|TK1151|PROTEIN

MWATLNHGGRTVFLEEDKSWIQQIQSKFPTLESYHVVYDTKVARAAELMAMGKREECNVVGDPRVSGCELALKGNLPAEIYEVEWDLIMVDAPTGYHDGAPGRMKAIYTAGLMGRNREEGETDVFVHDVDRVVEDEFSKVFLCEGYLSEQEGRLRHFTIPSHRARSGRPFCPL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G130790`
TK1151 ID	TkA08G130790
OH-1004 ID	LXL04_016979
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	69.800
Protein coverage (%)	TK1151 99.422 / OH-1004 57.966 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G130790

Location Chr08:33934070-33934591 (+)

Description Similar to GXM1: Glucuronoxylan 4-O-methyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g33800`	Methyltransferase catalyzing 4-O-methylation of glucuronic acid side chains on xylan.	Three Arabidopsis DUF579 domain-containing GXM proteins are methyltransferases catalyzing 4-o-methylation of glucuronic acid on xylan.2012 · DOI: 10.1093/pcp/pcs138
`At1g09610`	Methyltransferase catalyzing 4-O-methylation of glucuronic acid side chains on xylan.	Three Arabidopsis DUF579 domain-containing GXM proteins are methyltransferases catalyzing 4-o-methylation of glucuronic acid on xylan.2012 · DOI: 10.1093/pcp/pcs138
`At4g09990`	Methyltransferase catalyzing 4-O-methylation of glucuronic acid side chains on xylan.	Three Arabidopsis DUF579 domain-containing GXM proteins are methyltransferases catalyzing 4-o-methylation of glucuronic acid on xylan.2012 · DOI: 10.1093/pcp/pcs138
`At1g67330`	Involved in the methylation of glucuronic acid of different plant cell wall component, but mainly on side chains of arabinogalactans.	Two members of the DUF579 family are responsible for arabinogalactan methylation in Arabidopsis.2019 · DOI: 10.1002/pld3.117
`At5g67210`	Required for xylan biosynthesis, but not directly involved in catalyzing the addition of sugars to the growing polymer.	The DUF579 domain containing proteins IRX15 and IRX15-L affect xylan synthesis in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2010.04475.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016979 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005976 polysaccharide metabolic process Biological Process

GO:0006479 protein methylation Biological Process

GO:0009808 lignin metabolic process Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0032259 methylation Biological Process

GO:0045491 xylan metabolic process Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G09610

ath:AT1G27930

ath:AT1G33800

ath:AT1G67330

ath:AT4G09990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.576

Rank 1 · TkA08G130790 · TK1151

Endoplasmic reticulum0.209

Rank 2 · TkA08G130790 · TK1151

Extracellular0.107

Rank 3 · TkA08G130790 · TK1151

Cytoplasm0.071

Rank 4 · TkA08G130790 · TK1151

Nucleus0.051

Rank 5 · TkA08G130790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21729IRX15_IRX15L_GXM1-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G130790	`PF21729`	IRX15_IRX15L_GXM	1	157	3.8e-61	206.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQ32`	Arabidopsis thaliana	sp\|Q9LQ32\|GXM3_ARATH Glucuronoxylan 4-O-methyltransferase 3	71.700%	Swiss-Prot	High
`Q6NMK1`	Arabidopsis thaliana	sp\|Q6NMK1\|GXM1_ARATH Glucuronoxylan 4-O-methyltransferase 1	68.900%	Swiss-Prot	High
`Q9T0F7`	Arabidopsis thaliana	sp\|Q9T0F7\|GXM2_ARATH Glucuronoxylan 4-O-methyltransferase 2	68.200%	Swiss-Prot	High
`Q9FYG0`	Arabidopsis thaliana	sp\|Q9FYG0\|AGM2_ARATH Arabinogalactan O-methyltransferase 2	46.400%	Swiss-Prot	Medium
`Q9FH92`	Arabidopsis thaliana	sp\|Q9FH92\|IX15L_ARATH Protein IRX15-LIKE	39.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card