TkA08G130580 | RubberDandelionOmics

Gene overview

TkA08G130580

Reference: TK1151 Chr: Chr08 Coordinates: 33880657-33881824 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · TkA08G130580|TK1151|cDNA

TAATTTCATGATTTCATCAGTGATACTCGTCTTCTTCAAGTTCACTTCGCATCGTCAAACAGCTCAACACCATCTTCTGTCGATAGTTTTCGCTACTTCTCAAATCTCTGATCACTCTTCGTTGCAATATAGAAATTAGTGAAATTTCAGATGGAGCAAGAGGTGATAGACTCAGAGATGGTATTACCTACGCACCTAAGTTTTAAAAAGATTCAGATGTACGAGAAGTACCCAAAAGGTCAAGCTAGAGGGAGGCATTG...

CDS

Download CDS FASTA

375 bp · TkA08G130580|TK1151|CDS

ATGGAGCAAGAGGTGATAGACTCAGAGATGGTATTACCTACGCACCTAAGTTTTAAAAAGATTCAGATGTACGAGAAGTACCCAAAAGGTCAAGCTAGAGGGAGGCATTGGAAACATCTCAAGCAGATCATACAAGCTGAAAATTACCAAAATTATCCGGCCCACGAACCAAATTATGTTAATATTGAATCACCACCCTCAATGCACCCTCGGAAGCAAATTTGTGATATAACTGGATATGAGGCACCTTATAGTGATCC...

Protein

Download Protein FASTA

124 aa · TkA08G130580|TK1151|PROTEIN

MEQEVIDSEMVLPTHLSFKKIQMYEKYPKGQARGRHWKHLKQIIQAENYQNYPAHEPNYVNIESPPSMHPRKQICDITGYEAPYSDPRTHLRYANTEVFKVIRSLPNEYVQRYLALRNAAVVLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G130580`
TK1151 ID	TkA08G130580
OH-1004 ID	LXL04_031794
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G130580

Location Chr08:33880657-33881824 (+)

Description Similar to Ino80c: INO80 complex subunit C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38495`	Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031794 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010104 regulation of ethylene-activated signaling pathway Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0033044 regulation of chromosome organization Biological Process

GO:0034080 CENP-A containing chromatin assembly Biological Process

KEGG gene cross-reference

ath:AT4G38495

hsa:125476

mmu:225280

rno:291737

spo:2541949

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.736

Rank 1 · TkA08G130580 · TK1151

Cytoplasm0.301

Rank 2 · TkA08G130580 · TK1151

Mitochondrion0.033

Rank 3 · TkA08G130580 · TK1151

Cell membrane0.028

Rank 4 · TkA08G130580 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA08G130580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08265YL1_C74-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G130580	`PF08265`	YL1_C	74	102	1.1e-14	54.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWS0`	Arabidopsis thaliana	sp\|Q8RWS0\|EEN_ARATH Protein EIN6 ENHANCER	62.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card