TkA08G129700 | RubberDandelionOmics

Gene overview

TkA08G129700

Reference: TK1151 Chr: Chr08 Coordinates: 33662562-33666923 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2405 bp · TkA08G129700|TK1151|cDNA

AGAAGGTGGTGGAGATGGTGGGGTGTCACTGGTGGTGTATATAATTGATGTCCGTATTATGATAGGCCCTTTCCTTTCCTCTTTTCCACCTTTTGCTTTTCTCTCTTCTTCTCTCCCTCCATCTCTCCCACTCCCACCATCTCTTTGTTTCCCATTTTGCTTTATTTTTTTCCCTCGCAGTTTAATAGCTGGATTTCTGACCCAATTGTCTGCTTGATCATCAACACCATCACTTTCCTTTCCTCTTTTCAATTAAACCC...

CDS

Download CDS FASTA

882 bp · TkA08G129700|TK1151|CDS

ATGACTCCGGCGGCGGCGACGGCGACGGCGACCACCACTAATTACACGGCCGGGCAGTTTGGTGATACGACTTACACGAAGGTTTTTGTTGGTGGGTTGGCTTGGGAAACCCAGAAAGATACCATGAAAACGTACTTTGAGCAGTTTGGTGAGATCTTGGAAGCTGTTGTCATCACTGATAAGACCACCGGCAGATCTAAAGGCTATGGCTTTGTGACTTTCCGGGAGGCAGATGCGGCGATGAGGGCTTGTGTTGACGC...

Protein

Download Protein FASTA

293 aa · TkA08G129700|TK1151|PROTEIN

MTPAAATATATTTNYTAGQFGDTTYTKVFVGGLAWETQKDTMKTYFEQFGEILEAVVITDKTTGRSKGYGFVTFREADAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPNKLGGGRTIRVMGGYGGGYHHHNHNHHQGGAGGMGTTAFPSATAFPHYAIHQGIPFPATNLYGYSPYSPDYTYPTSYYNVYGGTNGQYPYYGANAGGGMITAAGAAAAFYPYLNMAEGGHGNYATGQSYGVYPHHLYQYSAVNSSGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G129700`
TK1151 ID	TkA08G129700
OH-1004 ID	LXL04_035474
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	44.400
Protein coverage (%)	TK1151 85.324 / OH-1004 73.786 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G129700

Location Chr08:33662562-33666923 (-)

Description Similar to ARP1: Probable RNA-binding protein ARP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54770`	Probable RNA-binding protein involved in the regulation of abscisic acid (ABA) response during seed germination.	An ABA-regulated putative RNA-binding protein affects seed germination of Arabidopsis under ABA or abiotic stress conditions.2013 · DOI: 10.1016/j.jplph.2012.09.002

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035474 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006974 DNA damage response Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0043488 regulation of mRNA stability Biological Process

GO:0048255 mRNA stabilization Biological Process

KEGG gene cross-reference

ath:AT3G54770

dre:405801

gga:768866

hsa:221662

xla:379265

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.856

Rank 1 · TkA08G129700 · TK1151

Cytoplasm0.261

Rank 2 · TkA08G129700 · TK1151

Cell membrane0.036

Rank 3 · TkA08G129700 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkA08G129700 · TK1151

Mitochondrion0.013

Rank 5 · TkA08G129700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16367RRM_726-89 aa

PF00076RRM_128-83 aa

PF14605Nup35_RRM_229-83 aa

PF14605Nup35_RRM_2236-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G129700	`PF16367`	RRM_7	26	89	0.00011	22.9
TkA08G129700	`PF00076`	RRM_1	28	83	2.1e-15	57.1
TkA08G129700	`PF14605`	Nup35_RRM_2	29	83	0.12	13.0
TkA08G129700	`PF14605`	Nup35_RRM_2	236	251	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1S3`	Arabidopsis thaliana	sp\|Q9M1S3\|ARP1_ARATH Probable RNA-binding protein ARP1	63.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card