TkA08G129670 | RubberDandelionOmics

Gene overview

TkA08G129670

Reference: TK1151 Chr: Chr08 Coordinates: 33647846-33650311 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · TkA08G129670|TK1151|cDNA

GTTAATCGTACGGTAGTCATCACCTTCTCGTCACGACGGTGTGCCTGGCGTTTCTGTTTCCTTGCGGCAATTCGTAGTCGATCATGTCATCCGATCCTAGCTGCACTGTTTATATTGGTAATTTGGATGAGCGAGTAAGCGATAGGGTTTTATACGATATACTTATTCAAGCTGGCCGTGTAGTTGATTTACACATTCCTCGAGATAAAGAAACTGATAAACCAAAAGGTTTTGCATTTGCGGAATATGAAACAGAGGAG...

CDS

Download CDS FASTA

390 bp · TkA08G129670|TK1151|CDS

ATGTCATCCGATCCTAGCTGCACTGTTTATATTGGTAATTTGGATGAGCGAGTAAGCGATAGGGTTTTATACGATATACTTATTCAAGCTGGCCGTGTAGTTGATTTACACATTCCTCGAGATAAAGAAACTGATAAACCAAAAGGTTTTGCATTTGCGGAATATGAAACAGAGGAGAGTGCAGATTATGCTGTCAGGCTGTTCACCGGTCTTGTGACCCTTTACAATAGAACCTTGAAATTTGTAGTATCTGGACATGA...

Protein

Download Protein FASTA

129 aa · TkA08G129670|TK1151|PROTEIN

MSSDPSCTVYIGNLDERVSDRVLYDILIQAGRVVDLHIPRDKETDKPKGFAFAEYETEESADYAVRLFTGLVTLYNRTLKFVVSGHDKAALNLQAPSMLTYNSPFTSQDIGEGSGLNKDKEVEGSYLIE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G129670`
TK1151 ID	TkA08G129670
OH-1004 ID	LXL04_031779
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G129670`
Location	Chr08:33647846-33650311 (+)
Description	Similar to sap-49: Splicing factor 3B subunit 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031779` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000375 RNA splicing, via transesterification reactions Biological Process GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11) Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0045292 mRNA cis splicing, via spliceosome Biological Process GO:1903241 U2-type prespliceosome assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005684 U2-type spliceosomal complex Cellular Component
KEGG gene cross-reference	cel:CELE_C08B11.5 hsa:10262 mmu:107701 rno:295270 spo:2542426 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.544

Rank 1 · TkA08G129670 · TK1151

Cytoplasm0.500

Rank 2 · TkA08G129670 · TK1151

Cell membrane0.054

Rank 3 · TkA08G129670 · TK1151

Endoplasmic reticulum0.040

Rank 4 · TkA08G129670 · TK1151

Lysosome / Vacuole0.037

Rank 5 · TkA08G129670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076RRM_19-80 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G129670	`PF00076`	RRM_1	9	80	6.7e-16	58.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card