TkA08G127910 | RubberDandelionOmics

Gene overview

TkA08G127910

Reference: TK1151 Chr: Chr08 Coordinates: 33250940-33251686 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · TkA08G127910|TK1151|cDNA

ATGGCGGTTGAAGCTTTGAATTCTCCGAGAACGGAAACCGCTCCTTTGTTTAAACAAGATTCCGGCAATCATCTGAGGTATTTGGACTCGTGGACAAAGGGCAAAAGATCGAAAAGGCCACGGGTGGATCAGCCACCTACCGAGGAGGAGTACCTTGCTTTCTGCCTTATGTTACTTGCCCGCGGTGGCCATGCGCCACAGCCGCGTGCTAAATCTCCGGCGCTTAGTATTGTGCTACCGCAGCCGGAATCGTTTGCTTA...

CDS

Download CDS FASTA

684 bp · TkA08G127910|TK1151|CDS

ATGGCGGTTGAAGCTTTGAATTCTCCGAGAACGGAAACCGCTCCTTTGTTTAAACAAGATTCCGGCAATCATCTGAGGTATTTGGACTCGTGGACAAAGGGCAAAAGATCGAAAAGGCCACGGGTGGATCAGCCACCTACCGAGGAGGAGTACCTTGCTTTCTGCCTTATGTTACTTGCCCGCGGTGGCCATGCGCCACAGCCGCGTGCTAAATCTCCGGCGCTTAGTATTGTGCTACCGCAGCCGGAATCGTTTGCTTA...

Protein

Download Protein FASTA

227 aa · TkA08G127910|TK1151|PROTEIN

MAVEALNSPRTETAPLFKQDSGNHLRYLDSWTKGKRSKRPRVDQPPTEEEYLAFCLMLLARGGHAPQPRAKSPALSIVLPQPESFAYKCSVCDKVFGSYQALGGHKASHRKNNPAAAGAEIEHGTHGGGSGRSHECSICHRSFATGQALGGHKRRHYEGVIGGGRANSGITSSEGVGSTNSQRGFDLNIPAMPEHLPGFADEEVESPHPTKKSRLFPPVKLQMAADQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G127910`
TK1151 ID	TkA08G127910
OH-1004 ID	LXL04_031755
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G127910

Location Chr08:33250940-33251686 (-)

Description Similar to ZAT10: Zinc finger protein ZAT10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27730`	Transcriptional repressor involved in abiotic stress responses.	LOS2, a genetic locus required for cold-responsive gene transcription encodes a bi-functional enolase.2002 · DOI: 10.1093/emboj/21.11.2692 Gain- and loss-of-function mutations in Zat10 enhance the tolerance of plants to abiotic stress.2006 · DOI: 10.1016/j.febslet.2006.11.002 Mapping methyl jasmonate-mediated transcriptional reprogramming of metabolism and cell cycle progression in cultured Arabidopsis cells.2008 · DOI: 10.1073/pnas.0711203105 Fine-tuning of early events in the jasmonate response.2008 · DOI: 10.4161/psb.3.10.5993
`At5g04340`	Probable transcription factor that regulates root development and phosphate (Pi) acquisition and homeostasis.	Phosphate homeostasis and root development in Arabidopsis are synchronized by the zinc finger transcription factor ZAT6.2007 · DOI: 10.1104/pp.107.101691
`At5g43170`	Transcriptional repressor probably involved in abiotic stress responses.	Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions.2004 · DOI: 10.1104/pp.104.046599
`At3g19580`	Transcriptional repressor involved in the inhibition of plant growth under abiotic stress conditions.	Functional identification of an Arabidopsis snf4 ortholog by screening for heterologous multicopy suppressors of snf4 deficiency in yeast.2000 · DOI: 10.1046/j.1365-313x.2000.00809.x Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions.2004 · DOI: 10.1104/pp.104.046599 Mapping methyl jasmonate-mediated transcriptional reprogramming of metabolism and cell cycle progression in cultured Arabidopsis cells.2008 · DOI: 10.1073/pnas.0711203105 Arabidopsis zinc-finger protein 2 is a negative regulator of ABA signaling during seed germination.2010 · DOI: 10.1016/j.jplph.2010.05.010 Arabidopsis Cys2/His2 zinc-finger proteins AZF1 and AZF2 negatively regulate abscisic acid-repressive and auxin-inducible genes under abiotic stress conditions.2011 · DOI: 10.1104/pp.111.182683 Gene network analysis and functional studies of senescence-associated genes reveal novel regulators of Arabidopsis leaf senescence.2012 · DOI: 10.1111/j.1744-7909.2012.01136.x
`At5g67450`	Transcriptional repressor involved in the inhibition of plant growth under abiotic stress conditions.	Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions.2004 · DOI: 10.1104/pp.104.046599 Arabidopsis Cys2/His2 zinc-finger proteins AZF1 and AZF2 negatively regulate abscisic acid-repressive and auxin-inducible genes under abiotic stress conditions.2011 · DOI: 10.1104/pp.111.182683

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031755 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010117 photoprotection Biological Process

KEGG gene cross-reference

ath:AT1G27730

ath:AT3G19580

ath:AT5G04340

ath:AT5G43170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.983

Rank 1 · TkA08G127910 · TK1151

Cytoplasm0.065

Rank 2 · TkA08G127910 · TK1151

Cell membrane0.022

Rank 3 · TkA08G127910 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA08G127910 · TK1151

Plastid0.009

Rank 5 · TkA08G127910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13912zf-C2H2_627-39 aa

PF23103Zf-C2H2_ZNF451_5th85-105 aa

PF13465zf-H2C2_285-97 aa

PF13912zf-C2H2_686-111 aa

PF13894zf-C2H2_487-109 aa

PF00096zf-C2H287-109 aa

PF12171zf-C2H2_jaz87-108 aa

PF12874zf-met87-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G127910	`PF13912`	zf-C2H2_6	27	39	1.2e-24	86.4
TkA08G127910	`PF23103`	Zf-C2H2_ZNF451_5th	85	105	0.35	11.4
TkA08G127910	`PF13465`	zf-H2C2_2	85	97	1.8	9.8
TkA08G127910	`PF13912`	zf-C2H2_6	86	111	1.2e-24	86.4
TkA08G127910	`PF13894`	zf-C2H2_4	87	109	1.4e-09	38.6
TkA08G127910	`PF00096`	zf-C2H2	87	109	9.4e-06	26.5
TkA08G127910	`PF12171`	zf-C2H2_jaz	87	108	0.0006	20.6
TkA08G127910	`PF12874`	zf-met	87	109	0.0049	17.9
TkA08G127910	`PF13913`	zf-C2HC_2	88	94	0.22	12.0
TkA08G127910	`PF24071`	Phage_zn_bind_3	89	115	0.019	15.6
TkA08G127910	`PF17123`	zf-RING_11	89	101	0.031	14.7
TkA08G127910	`PF25299`	ZZ_ADA2	89	110	0.062	14.2
TkA08G127910	`PF10367`	zf-Vps39_C	89	98	0.15	12.4
TkA08G127910	`PF13465`	zf-H2C2_2	105	114	1.8	9.8
TkA08G127910	`PF24071`	Phage_zn_bind_3	129	155	0.019	15.6
TkA08G127910	`PF13465`	zf-H2C2_2	132	145	1.8	9.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96289`	Arabidopsis thaliana	sp\|Q96289\|ZAT10_ARATH Zinc finger protein ZAT10	44.000%	Swiss-Prot	Medium
`O22533`	Arabidopsis thaliana	sp\|O22533\|ZAT6_ARATH Zinc finger protein ZAT6	44.900%	Swiss-Prot	Medium
`Q9SSW0`	Arabidopsis thaliana	sp\|Q9SSW0\|AZF3_ARATH Zinc finger protein AZF3	50.400%	Swiss-Prot	High
`Q9SSW2`	Arabidopsis thaliana	sp\|Q9SSW2\|AZF2_ARATH Zinc finger protein AZF2	33.200%	Swiss-Prot	Medium
`Q9SSW1`	Arabidopsis thaliana	sp\|Q9SSW1\|AZF1_ARATH Zinc finger protein AZF1	44.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card