Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2186 bp · TkA08G127190|TK1151|cDNA
AAAAAAGTAAAATAATTGACGTCTTAATATATACATAAACGAACTCTATTCGTAAATCATCTATGATCTTTGTAAAAAGTAATATACGCCTTATCTTTCAGGCTAATTCTTCTCGGCGGCGGCGAGTATTACGATGATCCAGGATTCTCCTCTGCCGCCTCAGGAGGAACTCAATACAGAATCAAAATCTGATGGCGAAGAAGAAGATCACCGCCTCCTACCAGTGCCCCAATCTCCCCTCCCCTTATCCACCGAAACCA...
1533 bp · TkA08G127190|TK1151|CDS
ATGATCCAGGATTCTCCTCTGCCGCCTCAGGAGGAACTCAATACAGAATCAAAATCTGATGGCGAAGAAGAAGATCACCGCCTCCTACCAGTGCCCCAATCTCCCCTCCCCTTATCCACCGAAACCAATCCTATCAACGATTACACCTCCGATGAAAAAGAGGCTGCATACGAGTCTCAAGAAAAGATCATAATCGATGGATTAGATTCATATTCAGATACAGCTGATTTCAACTCTACGCCACCGTTCTCGTGGAAGAA...
Protein
Download Protein FASTA510 aa · TkA08G127190|TK1151|PROTEIN
MIQDSPLPPQEELNTESKSDGEEEDHRLLPVPQSPLPLSTETNPINDYTSDEKEAAYESQEKIIIDGLDSYSDTADFNSTPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQAGAIAGYSLLWLLMWATGYGSPDPAIVRPDWGGYRKAPRGLLCREEYPKWAGLLLWFMAEIALIGADIQEVIGSAIAIQILSNGVLPLWAGVVITASDCFMFLLLENYGVRNLEAVFAVLISTMGLSFAWMFADAQPSGKELLIGLL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G127190 |
|---|---|
| TK1151 ID | TkA08G127190 |
| OH-1004 ID | LXL04_031742 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 95.500 |
| Protein coverage (%) | TK1151 99.608 / OH-1004 92.518Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G127190 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:33081363-33083930 (+) | |||||||||
| Description | Similar to NRAMP2: Metal transporter Nramp2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006826 iron ion transport Biological Process GO:0006828 manganese ion transport Biological Process GO:0006879 intracellular iron ion homeostasis Biological Process GO:0009617 response to bacterium Biological Process GO:0010015 root morphogenesis Biological Process GO:0010043 response to zinc ion Biological Process GO:0015691 cadmium ion transport Biological Process GO:0015692 lead ion transport Biological Process GO:0030001 metal ion transport Biological Process GO:0030003 intracellular monoatomic cation homeostasis Biological Process GO:0030026 intracellular manganese ion homeostasis Biological Process GO:0034755 iron ion transmembrane transport Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G47240 ath:AT2G23150 pop:18101156 pop:7472676 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01566Nramp95-130 aaPF01566Nramp155-494 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G127190 | PF01566 | Nramp | 95 | 130 | 3.2e-107 | 359.6 |
| TkA08G127190 | PF01566 | Nramp | 155 | 494 | 3.2e-107 | 359.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.