Gene Card
Gene overview
cDNA / CDS / Protein Sequences
864 bp · TkA08G126100|TK1151|cDNA
ATGCGAAGCTCAGACGCCGGTGTTACGGATGTTAATGAATCCAACACCATCCCCGACGAATACGACGCCACTCCGGAGACAAATATGGACGCTGTAAGTACAGACGCCGTCCCTGAGTCTGTACCTGAGTTGAAGTCGACTCCGTTTCATGAAGGAGAAAAGGTGCTCGCTTATCATAAGGGCCTTATTTACGAAGCCAAGGTCCTAGAAGTCGATTCCATGAAAGAACGTTTTTATGTTCATTATCTAGTAAGTATTAA...
864 bp · TkA08G126100|TK1151|CDS
ATGCGAAGCTCAGACGCCGGTGTTACGGATGTTAATGAATCCAACACCATCCCCGACGAATACGACGCCACTCCGGAGACAAATATGGACGCTGTAAGTACAGACGCCGTCCCTGAGTCTGTACCTGAGTTGAAGTCGACTCCGTTTCATGAAGGAGAAAAGGTGCTCGCTTATCATAAGGGCCTTATTTACGAAGCCAAGGTCCTAGAAGTCGATTCCATGAAAGAACGTTTTTATGTTCATTATCTAGTAAGTATTAA...
Protein
Download Protein FASTA287 aa · TkA08G126100|TK1151|PROTEIN
MRSSDAGVTDVNESNTIPDEYDATPETNMDAVSTDAVPESVPELKSTPFHEGEKVLAYHKGLIYEAKVLEVDSMKERFYVHYLVSINRWDEWIGMDRILKYNEENLQKQKELEIFTNLNPSVTKINKRKNISKVIGIQIPQKLKKHLVTYCEYVTNMGKLVKLPCSPNIDDILKMYLEHQSNKDMGPVGPSDEDTVNGLRCYFDKALPAMLLYKNERQQYEEATKNHISPSKIYGAEHLLRLVVKLPEILYNANIEEEML...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G126100 |
|---|---|
| TK1151 ID | TkA08G126100 |
| OH-1004 ID | LXL04_031723 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G126100 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:32772318-32773934 (-) | |||||||||
| Description | Similar to MRG2: Protein MRG2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006281 DNA repair Biological Process GO:0006325 chromatin organization Biological Process GO:0006335 DNA replication-dependent chromatin assembly Biological Process GO:0006337 nucleosome disassembly Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006368 transcription elongation by RNA polymerase II Biological Process GO:0008283 cell population proliferation Biological Process GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G02740 ath:AT4G37280 dha:DEHA2D03784g pon:100174761 rno:300891 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF22732MSL3_chromo-like49-113 aaPF11717Tudor-knot50-99 aaPF05712MRG126-287 aaPF11717Tudor-knot132-153 aaPF22732MSL3_chromo-like198-218 aaPF22732MSL3_chromo-like249-257 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G126100 | PF22732 | MSL3_chromo-like | 49 | 113 | 6.6e-11 | 42.8 |
| TkA08G126100 | PF11717 | Tudor-knot | 50 | 99 | 1.6e-08 | 35.1 |
| TkA08G126100 | PF05712 | MRG | 126 | 287 | 1.5e-43 | 149.2 |
| TkA08G126100 | PF11717 | Tudor-knot | 132 | 153 | 1.6e-08 | 35.1 |
| TkA08G126100 | PF22732 | MSL3_chromo-like | 198 | 218 | 6.6e-11 | 42.8 |
| TkA08G126100 | PF22732 | MSL3_chromo-like | 249 | 257 | 6.6e-11 | 42.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.