TkA08G125650 | RubberDandelionOmics

Gene overview

TkA08G125650

Reference: TK1151 Chr: Chr08 Coordinates: 32646354-32650060 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2921 bp · TkA08G125650|TK1151|cDNA

GATCCCTTTCAAGTTCCAATTTCAGATTTTCAGTTGATATATGTGATTCAATTTTGAAGAAAACCACCAATAAATCTTGCTTTAGATTTTGGCCGGAGTTCTTATAGAACCACCGGCGATCCCCCCAATAACTCAGGTCATTTCTGTTTCCATAATTGCCTCAAACCACCAGAATGGTTCAAATGGAGTTCCTGGGAATGGACTTCAGCTGTGTATTTGGAGCGTTAAGCGACGGCAAGTTTCCGGAAAAGGACTGCTTG...

CDS

Download CDS FASTA

714 bp · TkA08G125650|TK1151|CDS

ATGGTTCAAATGGAGTTCCTGGGAATGGACTTCAGCTGTGTATTTGGAGCGTTAAGCGACGGCAAGTTTCCGGAAAAGGACTGCTTGCTTCCGTTAATTTCTAAACTATTAGGTTACGCCATCGTTGCCGCTTCCACCACCGTTAAAGTGCCTCAGATTATGAAGATCCTGCAACATAAAAGTGTAAGAGGACTTAGCGTTATGGCCTTTGAATTGGAAGTGGTTGGTTACACAATAGCTTTAGCTTATTGTCTTCACAA...

Protein

Download Protein FASTA

237 aa · TkA08G125650|TK1151|PROTEIN

MVQMEFLGMDFSCVFGALSDGKFPEKDCLLPLISKLLGYAIVAASTTVKVPQIMKILQHKSVRGLSVMAFELEVVGYTIALAYCLHKGLPFSAYGELAFLLIQAIVLVATIYYFSQPVGTSTWIRALLYCGIAPTILAGKIDPLLFEALYASQHAIFFFARVPQIWENLKNKSTGELSFITSFMNSLGSLVRVFTSLQEKAPTSVVMGSVIGIVTNGAILTQIIMYQKPAKKGKKAD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G125650`
TK1151 ID	TkA08G125650
OH-1004 ID	LXL04_031715
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G125650

Location Chr08:32646354-32650060 (+)

Description Similar to At4g07390: Mannose-P-dolichol utilization defect 1 protein homolog 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g07390`	Required for normal utilization of mannose-dolichol phosphate (Dol-P-Man) in the synthesis of N-linked and O-linked oligosaccharides and GPI anchors.	No verified direct reference in this release
`At5g59470`	Mannose-P-dolichol utilization defect 1 protein homolog 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031715 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process

GO:0009312 oligosaccharide biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT4G07390

ath:AT5G59470

dme:Dmel_CG3792

hsa:9526

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.781

Rank 1 · TkA08G125650 · TK1151

Golgi apparatus0.177

Rank 2 · TkA08G125650 · TK1151

Cytoplasm0.104

Rank 3 · TkA08G125650 · TK1151

Cell membrane0.066

Rank 4 · TkA08G125650 · TK1151

Nucleus0.044

Rank 5 · TkA08G125650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04193PQ-loop33-92 aa

PF28566MEX1_N46-116 aa

PF03083MtN3_slv50-113 aa

PF01989AcnX_swivel_put119-171 aa

PF28566MEX1_N149-226 aa

PF04193PQ-loop154-203 aa

PF03083MtN3_slv156-228 aa

PF01989AcnX_swivel_put186-230 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G125650	`PF04193`	PQ-loop	33	92	1e-29	102.8
TkA08G125650	`PF28566`	MEX1_N	46	116	0.00033	21.0
TkA08G125650	`PF03083`	MtN3_slv	50	113	2.7e-05	24.8
TkA08G125650	`PF01989`	AcnX_swivel_put	119	171	0.0036	17.6
TkA08G125650	`PF28566`	MEX1_N	149	226	0.00033	21.0
TkA08G125650	`PF04193`	PQ-loop	154	203	1e-29	102.8
TkA08G125650	`PF03083`	MtN3_slv	156	228	2.7e-05	24.8
TkA08G125650	`PF01989`	AcnX_swivel_put	186	230	0.0036	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY63`	Arabidopsis thaliana	sp\|Q8VY63\|MPU12_ARATH Mannose-P-dolichol utilization defect 1 protein homolog 2	75.300%	Swiss-Prot	High
`Q9LTI3`	Arabidopsis thaliana	sp\|Q9LTI3\|MPU11_ARATH Mannose-P-dolichol utilization defect 1 protein homolog 1	66.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card