TkA08G125630 | RubberDandelionOmics

Gene overview

TkA08G125630

Reference: TK1151 Chr: Chr08 Coordinates: 32640966-32642798 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1324 bp · TkA08G125630|TK1151|cDNA

TAGTCTCCTCCCAATAAGACAAAGGGGACCACACACCCCTCTCCCTGTTTTCCAAAATCTAACATTCCCACAACTACTTCATTCCACAATGTGGTCATACTTCTACTACTACTACTACTACAAATCATCTTTTCAATTGTGTCAAGTTTTTGTGCACTAACAACAATGGAAGGACTTCCTATGTTAACTTGTCTCATACAACATACGTTAAAAGGTTTATGTAATTCGGATTCTTCTTCAGATAGTAACGCTATTTCCAC...

CDS

Download CDS FASTA

1083 bp · TkA08G125630|TK1151|CDS

ATGGAAGGACTTCCTATGTTAACTTGTCTCATACAACATACGTTAAAAGGTTTATGTAATTCGGATTCTTCTTCAGATAGTAACGCTATTTCCACTACCAAATGGGTTTACGCTGTTTTCTGGCGAACTTTGCCTCGAATCTACCCGCCTCCTAAGTGGGAGTATGAAGCTGGAGGCGTTCTTGATCGAGCTAAAGGAAACAAACGTAATTGGATTCTTGTGTGGGAAGATGGGTTTTGTGATCTTGATGAATGTGAGCG...

Protein

Download Protein FASTA

360 aa · TkA08G125630|TK1151|PROTEIN

MEGLPMLTCLIQHTLKGLCNSDSSSDSNAISTTKWVYAVFWRTLPRIYPPPKWEYEAGGVLDRAKGNKRNWILVWEDGFCDLDECERIGKNDGLLKGRFGSDIFFKLSHEVYNYGEGLIGKVAADNSHRWVFNDGSNEATIDPNFLSSWNATIDPQPKAWDSHFNSGIKTIAVISVREGIIQLGSFDKILEDLNLVLTIQRKFSYLRSIPGLFPIQRPFSTVQLPYNPQKHTSLIVGSDQAQQQNGPRVNIHGDGEGHIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G125630`
TK1151 ID	TkA08G125630
OH-1004 ID	LXL04_011562
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	45.800
Protein coverage (%)	TK1151 63.889 / OH-1004 65.029 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G125630

Location Chr08:32640966-32642798 (-)

Description Similar to RSS3: Protein RICE SALT SENSITIVE 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0446000`	Involved in the repression of jasmonate (JA)-induced genes.	RICE SALT SENSITIVE3 forms a ternary complex with JAZ and class-C bHLH factors and regulates jasmonate-induced gene expression and root cell elongation.2013 · DOI: 10.1105/tpc.113.112052

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011562 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010089 xylem development Biological Process

GO:0010479 stele development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G06150

ath:AT2G27230

ath:AT2G31280

dosa:Os11g0446000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.708

Rank 1 · TkA08G125630 · TK1151

Cytoplasm0.237

Rank 2 · TkA08G125630 · TK1151

Cell membrane0.136

Rank 3 · TkA08G125630 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA08G125630 · TK1151

Lysosome / Vacuole0.033

Rank 5 · TkA08G125630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14215bHLH-MYC_N12-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G125630	`PF14215`	bHLH-MYC_N	12	203	2.2e-27	97.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`K4PW38`	Oryza sativa subsp. japonica	sp\|K4PW38\|RSS3_ORYSJ Protein RICE SALT SENSITIVE 3	39.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card