TkA08G125330 | RubberDandelionOmics

Gene overview

TkA08G125330

Reference: TK1151 Chr: Chr08 Coordinates: 32564260-32566543 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1623 bp · TkA08G125330|TK1151|cDNA

CTAAAACGGTATACCAATCCTACGGACAGAATTGATTTTTGACTTTTTACTAACATCTGAACCGTTCAATTGGTCTTCTCTAAAAAACATGAATGCTGGGCCACACATGACGTTACGGTCAATCTCTGACATTTTCTCCACCCAAGATTTCAACACGTGTTAACTGCTTACTGGTTTCAACCTTTGACTGCAGTTAGACGTACAGGGGTATTTTGGTCATTTACCAGGGGCACCCACCGCATCATCTCTTTGACACCCCC...

CDS

Download CDS FASTA

1038 bp · TkA08G125330|TK1151|CDS

ATGGCGGTGGAGCTCATGAATTCTATCAGAAACAGTAGTTTTAATGGTAAAATTGAAGAAATCGCCGTCAGAGAAGCCGGTGCTGCTGGACTTAAGAGCCTTGAGAATCTAATCGGATTGCTTTCATCCCATTCGCATAACCAACCGTCGTACTCTGTCGGCACTAGCGCTGCTTCTTCCACCACCGATTATGTAGCTGTTGCTGATGTCGCTGTCAATAAGTTTAAGAAATTCATCTCTCTCCTAGATCGAACTTCCAC...

Protein

Download Protein FASTA

345 aa · TkA08G125330|TK1151|PROTEIN

MAVELMNSIRNSSFNGKIEEIAVREAGAAGLKSLENLIGLLSSHSHNQPSYSVGTSAASSTTDYVAVADVAVNKFKKFISLLDRTSTGHARFRRGPVSKAPVVLEKKSAFTPTAGNSSQQYNQTVAATAEKVYSAAPIQQRLPQVPQLSEPRSLAKSGSFDRKDVPPSTINFAAAAASPANSFMSSLTGDTDGLQPSMSSGFQITNLSQVSSAGQPNLSSSSFKRKCNSVDDSHTKCTNSSGRCHCSKKRKSRMKRVVRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G125330`
TK1151 ID	TkA08G125330
OH-1004 ID	LXL04_031713
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G125330

Location Chr08:32564260-32566543 (-)

Description Similar to WRKY7: Probable WRKY transcription factor 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24240`	Transcription factor.	No verified direct reference in this release
`At2g23320`	Transcription factor.	No verified direct reference in this release
`At4g31550`	Transcription factor.	Transcription factors WRKY70 and WRKY11 served as regulators in rhizobacterium Bacillus cereus AR156-induced systemic resistance to Pseudomonas syringae pv. tomato DC3000 in Arabidopsis.2016 · DOI: 10.1093/jxb/erv445
`At2g24570`	Transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0287400`	Transcription factor.	Interactions of two abscisic-acid induced WRKY genes in repressing gibberellin signaling in aleurone cells.2006 · DOI: 10.1111/j.1365-313x.2006.02694.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031713 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT2G23320

ath:AT2G24570

ath:AT2G30590

ath:AT4G24240

ath:AT4G31550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945

Rank 1 · TkA08G125330 · TK1151

Cytoplasm0.143

Rank 2 · TkA08G125330 · TK1151

Cell membrane0.021

Rank 3 · TkA08G125330 · TK1151

Mitochondrion0.016

Rank 4 · TkA08G125330 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA08G125330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23092Ubiquitin_645-86 aa

PF05755REF98-146 aa

PF23092Ubiquitin_6194-222 aa

PF10533Plant_zn_clust224-269 aa

PF00053EGF_laminin226-249 aa

PF03106WRKY234-250 aa

PF03106WRKY273-329 aa

PF10533Plant_zn_clust296-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G125330	`PF23092`	Ubiquitin_6	45	86	0.22	12.1
TkA08G125330	`PF05755`	REF	98	146	0.0033	18.1
TkA08G125330	`PF23092`	Ubiquitin_6	194	222	0.22	12.1
TkA08G125330	`PF10533`	Plant_zn_clust	224	269	1.1e-18	67.8
TkA08G125330	`PF00053`	EGF_laminin	226	249	1.5	9.7
TkA08G125330	`PF03106`	WRKY	234	250	3.8e-26	91.8
TkA08G125330	`PF03106`	WRKY	273	329	3.8e-26	91.8
TkA08G125330	`PF10533`	Plant_zn_clust	296	305	1.1e-18	67.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STX0`	Arabidopsis thaliana	sp\|Q9STX0\|WRKY7_ARATH Probable WRKY transcription factor 7	50.600%	Swiss-Prot	High
`O22176`	Arabidopsis thaliana	sp\|O22176\|WRK15_ARATH Probable WRKY transcription factor 15	47.700%	Swiss-Prot	Medium
`Q9SV15`	Arabidopsis thaliana	sp\|Q9SV15\|WRK11_ARATH Probable WRKY transcription factor 11	44.500%	Swiss-Prot	Medium
`Q9SJA8`	Arabidopsis thaliana	sp\|Q9SJA8\|WRK17_ARATH Probable WRKY transcription factor 17	44.100%	Swiss-Prot	Medium
`Q0JEE2`	Oryza sativa subsp. japonica	sp\|Q0JEE2\|WRK51_ORYSJ WRKY transcription factor WRKY51	42.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card