RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G125110
Reference: TK1151 Chr: Chr08 Coordinates: 32495241-32500607 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3396 bp · TkA08G125110|TK1151|cDNA

CTAAACTGCCCTTCTCTGTGTGTTAGATGATTTGGTCCATTCCATGTTAAGAGGTTACTGAATCACTTTCAGGGCTCCATAAAATTACTTCATTTCTGTAAAGATACAGAGAACTCATCTTCATTTTCTCTCTCTGTAACTATAACTGTTTCCTGGACCACCTTCCTTTTGCATTTTTCACATGATGGAAGCGCCTCCGGCGACGACCACGACGGCGGAGGATTGTTGTGTGAAGGTAGCAGTACATATTCGACCGCTTA...

CDS

Download CDS FASTA

3087 bp · TkA08G125110|TK1151|CDS

ATGATGGAAGCGCCTCCGGCGACGACCACGACGGCGGAGGATTGTTGTGTGAAGGTAGCAGTACATATTCGACCGCTTATTGGAGATGAGAAGCTTCAAGCTTGTCAAGATTGTGTCGCTGTCGTACCCGGAAAACCCCAGGTGCAACTTGGTACACATTCCTTCACTTTCGATCATGTCTATGGAAGCTCCGGTTCCCCATCATCCGCCATGTTTGAAGACTGCGTTTCTCCCCTTGTTGACGGTCTATTTCAAGGATA...

Protein

Download Protein FASTA

1028 aa · TkA08G125110|TK1151|PROTEIN

MMEAPPATTTTAEDCCVKVAVHIRPLIGDEKLQACQDCVAVVPGKPQVQLGTHSFTFDHVYGSSGSPSSAMFEDCVSPLVDGLFQGYNATVLAYGQTGSGKTYTMGTGFKDGYQAGLIPQAMTALFNKIKTLQDKIEFQLHVSFIEILKEEVRDLLDSKSEITHGQNGKLNSPGKPPIQIRETSNGVITLAGSTECSIKTLKEMSDCLEHGSLSRATGSTNMNNQSSRSHAIFTITLEQMSKTDSNDSMCDEYLCAKLHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G125110
TK1151 IDTkA08G125110
OH-1004 IDLXL04_031709
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G125110
LocationChr08:32495241-32500607 (+)
DescriptionSimilar to KIN4A: Kinesin-like protein KIN-4A
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g47820 Kinesin-like motor protein involved in the control of the oriented deposition of cellulose microfibrils.
A kinesin-like protein is essential for oriented deposition of cellulose microfibrils and cell wall strength.2002 · DOI: 10.1105/tpc.005801
Single molecule analysis of the Arabidopsis FRA1 kinesin shows that it is a functional motor protein with unusually high processivity.2011 · DOI: 10.1093/mp/ssr077
Kinesin-4 Functions in Vesicular Transport on Cortical Microtubules and Regulates Cell Wall Mechanics during Cell Elongation in Plants.2015 · DOI: 10.1016/j.molp.2015.01.004
At3g50240 Kinesin-like motor protein involved in the control of the oriented deposition of cellulose microfibrils. No verified direct reference in this release
At5g60930 Kinesin-like motor protein involved in the control of the oriented deposition of cellulose microfibrils. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os09g0114500 Microtubule-dependent motor protein involved in the control of the oriented deposition of cellulose microfibrils.
Mutation of rice BC12/GDD1, which encodes a kinesin-like protein that binds to a GA biosynthesis gene promoter, leads to dwarfism with impaired cell elongation.2011 · DOI: 10.1105/tpc.110.081901
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031709 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0007018 microtubule-based movement Biological Process
GO:0007052 mitotic spindle organization Biological Process
GO:0009832 plant-type cell wall biogenesis Biological Process
GO:0009937 regulation of gibberellic acid mediated signaling pathway Biological Process
GO:0010215 cellulose microfibril organization Biological Process
GO:0030705 cytoskeleton-dependent intracellular transport Biological Process
GO:0042127 regulation of cell population proliferation Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0051231 spindle elongation Biological Process
GO:0071555 cell wall organization Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT3G50240
ath:AT5G47820
ath:AT5G60930
dosa:Os09g0114500
ghi:107917911
osa:4346402
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.666
Rank 1 · TkA08G125110 · TK1151
Nucleus0.269
Rank 2 · TkA08G125110 · TK1151
Cell membrane0.147
Rank 3 · TkA08G125110 · TK1151
Golgi apparatus0.073
Rank 4 · TkA08G125110 · TK1151
Mitochondrion0.049
Rank 5 · TkA08G125110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00225Kinesin44-361 aa
PF16796Microtub_bd45-156 aa
PF25764KIF21A_4th403-424 aa
PF25764KIF21A_4th470-647 aa
PF03009GDPD552-664 aa
PF16796Microtub_bd572-638 aa
PF00225Kinesin654-699 aa
PF25764KIF21A_4th662-700 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G125110PF00225Kinesin443612.7e-105352.7
TkA08G125110PF16796Microtub_bd451567.1e-2175.4
TkA08G125110PF25764KIF21A_4th4034243.2e-53180.8
TkA08G125110PF25764KIF21A_4th4706473.2e-53180.8
TkA08G125110PF03009GDPD5526640.5611.0
TkA08G125110PF16796Microtub_bd5726387.1e-2175.4
TkA08G125110PF00225Kinesin6546992.7e-105352.7
TkA08G125110PF25764KIF21A_4th6627003.2e-53180.8
TkA08G125110PF00225Kinesin8339092.7e-105352.7
TkA08G125110PF25764KIF21A_4th8578823.2e-53180.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8GS71Arabidopsis thalianasp|Q8GS71|KN4A_ARATH Kinesin-like protein KIN-4A69.900%Swiss-ProtHigh
Q94LW7Arabidopsis thalianasp|Q94LW7|KN4B_ARATH Kinesin-like protein KIN-4B60.900%Swiss-ProtHigh
F4K0J3Arabidopsis thalianasp|F4K0J3|KN4C_ARATH Kinesin-like protein KIN-4C50.000%Swiss-ProtHigh
Q6YUL8Oryza sativa subsp. japonicasp|Q6YUL8|KN4A_ORYSJ Kinesin-like protein KIN-4A65.600%Swiss-ProtHigh

JBrowse

View in Genome Browser