TkA08G124020 | RubberDandelionOmics

Gene overview

TkA08G124020

Reference: TK1151 Chr: Chr08 Coordinates: 32220354-32223912 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1781 bp · TkA08G124020|TK1151|cDNA

GTCGATTCGAAAACAGGAACCCATTTAGCCGTTGTTTTACCCGAAATCAAGTAGCCCAATTACCCGAAATAAACTAGCCCATTAATTCCATTGTCTGATCCGGCGACCTAGACTAAATCAACGTAAACTAATCCCGATCAGCGCCATAGCCGCACTGCTTCCTTCACTTCAAATTGGCTTCGAGTTCGCCAAGATTTTCTGGTTTGACATCTCCAATTGGCGTCGACCTTCAACTGGCGTCGACTTTCAAACAGCTTCAA...

CDS

Download CDS FASTA

1320 bp · TkA08G124020|TK1151|CDS

ATGGAGGATGATGATTCTACGATTGCGTCGGAAGCCAACAATAAAGAATCCATGGAAGTGGAAGTTGCTCCGGCTCTCATCTCCGTTCATCCTGCTCAGGACTCCGTCGCTGTCGCCGTTGGCTCTGAGCTTCGTGTATTTAATCTCCGAGAAGGTTGCCCTGTAACTTTAGGAGCTGACTCAAATGAAGCATGTCATCATAAGGAATCTATCAGAGCAATTCGCTATGGTGCAAAAGGTAAACTCTTCGTGTCTGCTGG...

Protein

Download Protein FASTA

439 aa · TkA08G124020|TK1151|PROTEIN

MEDDDSTIASEANNKESMEVEVAPALISVHPAQDSVAVAVGSELRVFNLREGCPVTLGADSNEACHHKESIRAIRYGAKGKLFVSAGDDKVVKIWATDSWRCIYSVPTEKKVSAVAISDNGQFVCYADKFGVVWVVELDELNENQTPVQKKGSPLLAHYCSIITSLEFSPDGQFIVTADRDFKIRVSMFPKKPIDGAHEIQSYCLGHTEFVSSLAFIYNQEFPQGYLVSGSGDSTVRLWDFTSGLLLHTCEVGSEVGEQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G124020`
TK1151 ID	TkA08G124020
OH-1004 ID	LXL04_018800
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G124020`
Location	Chr08:32220354-32223912 (-)
Description	Similar to wdr4: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018800` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006400 tRNA modification Biological Process GO:0006974 DNA damage response Biological Process GO:0106004 tRNA (guanine-N7)-methylation Biological Process GO:0005634 nucleus Cellular Component GO:0005694 chromosome Cellular Component GO:0005829 cytosol Cellular Component GO:0043527 tRNA methyltransferase complex Cellular Component GO:0106143 tRNA (m7G46) methyltransferase complex Cellular Component GO:0008047 enzyme activator activity Molecular Function
KEGG gene cross-reference	bta:508051 ddi:DDB_G0281061 xla:380200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.641

Rank 1 · TkA08G124020 · TK1151

Cytoplasm0.387

Rank 2 · TkA08G124020 · TK1151

Mitochondrion0.054

Rank 3 · TkA08G124020 · TK1151

Cell membrane0.047

Rank 4 · TkA08G124020 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA08G124020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23609Beta-prop_EIPR18-95 aa

PF23098Beta-prop_NOL10_N11-125 aa

PF23383Beta-prop_IFT140_1st12-100 aa

PF24796WDR5517-125 aa

PF03178CPSF_A19-51 aa

PF23414Beta-prop_EML_220-80 aa

PF23409Beta-prop_EML27-148 aa

PF23381Beta-prop_IFT122_1st30-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G124020	`PF23609`	Beta-prop_EIPR1	8	95	3.2e-06	27.5
TkA08G124020	`PF23098`	Beta-prop_NOL10_N	11	125	7.9e-06	26.0
TkA08G124020	`PF23383`	Beta-prop_IFT140_1st	12	100	6.1e-05	22.6
TkA08G124020	`PF24796`	WDR55	17	125	1.3e-10	41.6
TkA08G124020	`PF03178`	CPSF_A	19	51	0.00011	22.4
TkA08G124020	`PF23414`	Beta-prop_EML_2	20	80	6.4e-16	59.2
TkA08G124020	`PF23409`	Beta-prop_EML	27	148	4.9e-05	23.7
TkA08G124020	`PF23381`	Beta-prop_IFT122_1st	30	258	1.2e-20	74.7
TkA08G124020	`PF24807`	WD40_CDC20-Fz	33	257	3.6e-14	53.5
TkA08G124020	`PF12894`	ANAPC4_WD40	42	116	2.1e-08	35.0
TkA08G124020	`PF25174`	Beta-prop_THOC3	43	251	2.9e-22	79.7
TkA08G124020	`PF24817`	WD40_WDHD1_1st	43	138	1.4e-20	74.4
TkA08G124020	`PF25168`	Beta-prop_WDR36-Utp21_2nd	43	191	3.4e-11	43.7
TkA08G124020	`PF24780`	WD40_MABP1-WDR62_1st	62	148	1.1e-06	28.9
TkA08G124020	`PF23869`	Beta-prop_WDR75_1st	64	126	1.8e-08	34.8
TkA08G124020	`PF23393`	Beta-prop_WDR90_POC16_2nd	64	95	4.4e-06	26.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card