TkA08G122380 | RubberDandelionOmics

Gene overview

TkA08G122380

Reference: TK1151 Chr: Chr08 Coordinates: 31852029-31854024 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1778 bp · TkA08G122380|TK1151|cDNA

GTATAATCTGAGGATTGACTAGTCAACAGGACTAATATATAAGTGCAAGATATGAGTCATAAATATATGCACAAAAGTGGAAATGATATTCATTGCCCAAAAAAGACAATAATAAGCAACAGTTTCCACCATGTTAAATAGGGTTGACACCGTCAACCTTTATTATAGTCCTAAAATTCGGAAATTCCAATTTATCTAAGATAGTATTCGATGGACAGAAATCTTTAAAAATTATAACTCTTTTTTACAAAAATCTCTAA...

CDS

Download CDS FASTA

1014 bp · TkA08G122380|TK1151|CDS

ATGGCGATGATGTTAGATAACTCATGCGATGGTGGGATTCTGTTATCTTTAGACTCCCACAAAGCGGTGCCTGCCCCTTTTCTCACCAAGACTTACCAACTTGTCGATGATCCAACCACCGACCATATCGTCTCGTGGGGTGAAGATGACACCACCTTCGTCGTCTGGCGTCCGCCGGAATTCGCACGTGATCTACTTCCGAACTACTTCAAACACAACAACTTTTCGTCGTTTGTGCGCCAACTAAACACTTATGGTTT...

Protein

Download Protein FASTA

337 aa · TkA08G122380|TK1151|PROTEIN

MAMMLDNSCDGGILLSLDSHKAVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTSQPQVTLNHHHHPHHFTGNGFFAYPSTRSISPPDSDEHLYCDNSPPLSSPTATTTTADNERLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVAPSNSYPSSLLLSSNNSNMNGQILMQKQQQQTSFLNGSNNTNCNANVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G122380`
TK1151 ID	TkA08G122380
OH-1004 ID	LXL04_031694
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G122380

Location Chr08:31852029-31854024 (-)

Description Similar to HSFB4: Heat stress transcription factor B-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g46264`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0455200`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os08g0471000`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os03g0366800`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os07g0640900`	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031694 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0008356 asymmetric cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G46264

dosa:Os07g0640900

dosa:Os09g0455200

osa:107275533

osa:107277264

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.956

Rank 1 · TkA08G122380 · TK1151

Cytoplasm0.160

Rank 2 · TkA08G122380 · TK1151

Cell membrane0.017

Rank 3 · TkA08G122380 · TK1151

Mitochondrion0.011

Rank 4 · TkA08G122380 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA08G122380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00447HSF_DNA-bind27-116 aa

PF07216LcrG100-124 aa

PF07216LcrG175-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G122380	`PF00447`	HSF_DNA-bind	27	116	6e-30	104.4
TkA08G122380	`PF07216`	LcrG	100	124	0.34	11.7
TkA08G122380	`PF07216`	LcrG	175	195	0.34	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C635`	Arabidopsis thaliana	sp\|Q9C635\|HSFB4_ARATH Heat stress transcription factor B-4	55.800%	Swiss-Prot	High
`Q67U94`	Oryza sativa subsp. japonica	sp\|Q67U94\|HFB4C_ORYSJ Heat stress transcription factor B-4c	55.800%	Swiss-Prot	Medium
`Q6Z9R8`	Oryza sativa subsp. japonica	sp\|Q6Z9R8\|HFB4A_ORYSJ Putative heat stress transcription factor B-4a	51.500%	Swiss-Prot	Medium
`Q10KX8`	Oryza sativa subsp. japonica	sp\|Q10KX8\|HFB4D_ORYSJ Heat stress transcription factor B-4d	52.500%	Swiss-Prot	Medium
`Q7XHZ0`	Oryza sativa subsp. japonica	sp\|Q7XHZ0\|HFB4B_ORYSJ Heat stress transcription factor B-4b	93.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card