TkA08G122150 | RubberDandelionOmics

Gene overview

TkA08G122150

Reference: TK1151 Chr: Chr08 Coordinates: 31783923-31786414 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1945 bp · TkA08G122150|TK1151|cDNA

GGGGCACTTGTCGGCTCCATTAACCCGCACCAGGATTCTTTATTACGCACAAAAGTTCACTGAATCACGGACCCTTCGATTGACCACTCCTAATTAGGCACACAATCCCTCCCTCATTACCAAACCTTCTCTGTTTCATACTGTTCAATTAGCAACTAATTCAGGTGACTTTCTTGCATTTTCATACTTTTACTGTTTGTTGAGATGATTTCGTTATTATCCTGTCTTGATTTGTCCAAAGTTGAACGAACTTTGTTTGT...

CDS

Download CDS FASTA

1164 bp · TkA08G122150|TK1151|CDS

ATGAACTTCAAAAGCTTCGGAAACCAGACGGCGGAGGTGGGGAACGGGAGACCACCGGGAGGCTTCCATTTGGCAAGACAAGGCTCGATATATTCGTTAACTTTCGATGAGCTACAAAACACCATGGGTAGCATGGGAAAGGATTTCGGGTCTATGAACATGGACGAATTACTAAAAAGCATTTGGAACGCCGAGGAAGTTCAAACAACCGGAACCATCACCTGCGTACAAGAATCCGGCGGCGATGGTGGAGCAAATAT...

Protein

Download Protein FASTA

387 aa · TkA08G122150|TK1151|PROTEIN

MNFKSFGNQTAEVGNGRPPGGFHLARQGSIYSLTFDELQNTMGSMGKDFGSMNMDELLKSIWNAEEVQTTGTITCVQESGGDGGANMNIQRQGSLTLPRTLSQKTVDEVWKDISKEFNGFGQPNLPQRQQTLGEMTLEEFLVKAGVVREEAQSPVKPNDNALFPNLTNPQNNPGFGAVGFQQASNRNNNQIAFQPANLPLNVNGVRSNPQQQLFPKQTNHAYGAPMAIPPSKQLGSPVVRNGVVGLPDQGMNGNLMGGMA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G122150`
TK1151 ID	TkA08G122150
OH-1004 ID	LXL04_031687
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 96.020 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G122150

Location Chr08:31783923-31786414 (+)

Description Similar to ABF2: ABSCISIC ACID-INSENSITIVE 5-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g45249`	Involved in ABA and stress responses and acts as a positive component of glucose signal transduction.	Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.2000 · DOI: 10.1073/pnas.190309197 AREB1 is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.2005 · DOI: 10.1105/tpc.105.035659 Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.2006 · DOI: 10.1007/s11103-005-2418-5
`At3g19290`	Functions as a transcriptional activator in the ABA-inducible expression of LTI65/RD29B (AC Q04980).	Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.2000 · DOI: 10.1073/pnas.190309197 Arabidopsis basic leucine zipper proteins that mediate stress-responsive abscisic acid signaling.2002 · DOI: 10.1105/tpc.010362 The effect of ABRE BINDING FACTOR 4-mediated FYVE1 on salt stress tolerance in Arabidopsis.2020 · DOI: 10.1016/j.plantsci.2020.110489
`At1g49720`	Binds to the ABA-responsive element (ABRE).	No verified direct reference in this release
`UniProt: Q9M7Q3`	Binds to the ABA-responsive element (ABRE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0766700`	Transcriptional activator that mediates abscisic acid (ABA) signaling.	Characterization of OsbZIP23 as a key player of the basic leucine zipper transcription factor family for conferring abscisic acid sensitivity and salinity and drought tolerance in rice.2008 · DOI: 10.1104/pp.108.128199 Feedback Regulation of ABA Signaling and Biosynthesis by a bZIP Transcription Factor Targets Drought-Resistance-Related Genes.2016 · DOI: 10.1104/pp.16.00469 OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.2016 · DOI: 10.1016/j.devcel.2016.06.011

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031687 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0010152 pollen maturation Biological Process

GO:0010255 glucose mediated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G45249

ath:AT1G49720

ath:AT3G19290

ath:AT4G34000

dosa:Os01g0859300

osa:4325061

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · TkA08G122150 · TK1151

Cytoplasm0.133

Rank 2 · TkA08G122150 · TK1151

Cell membrane0.023

Rank 3 · TkA08G122150 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA08G122150 · TK1151

Mitochondrion0.009

Rank 5 · TkA08G122150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11796DUF3323283-380 aa

PF14661HAUS6_N304-370 aa

PF07716bZIP_2308-358 aa

PF00170bZIP_1309-358 aa

PF03131bZIP_Maf309-363 aa

PF02370M334-350 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G122150	`PF11796`	DUF3323	283	380	0.2	12.2
TkA08G122150	`PF14661`	HAUS6_N	304	370	1.2	9.4
TkA08G122150	`PF07716`	bZIP_2	308	358	8.4e-11	42.5
TkA08G122150	`PF00170`	bZIP_1	309	358	1e-12	48.6
TkA08G122150	`PF03131`	bZIP_Maf	309	363	0.00021	22.5
TkA08G122150	`PF02370`	M	334	350	0.87	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7Q4`	Arabidopsis thaliana	sp\|Q9M7Q4\|AI5L5_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 5	53.900%	Swiss-Prot	High
`Q9M7Q2`	Arabidopsis thaliana	sp\|Q9M7Q2\|AI5L7_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 7	46.200%	Swiss-Prot	Medium
`Q9M7Q5`	Arabidopsis thaliana	sp\|Q9M7Q5\|AI5L4_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 4	44.600%	Swiss-Prot	Medium
`Q9M7Q3`	Arabidopsis thaliana	sp\|Q9M7Q3\|AI5L6_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 6	42.800%	Swiss-Prot	Medium
`Q6Z312`	Oryza sativa subsp. japonica	sp\|Q6Z312\|BZP23_ORYSJ bZIP transcription factor 23	46.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card