TkA08G121190 | RubberDandelionOmics

Gene overview

TkA08G121190

Reference: TK1151 Chr: Chr08 Coordinates: 31537354-31540661 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

417 bp · TkA08G121190|TK1151|cDNA

CGAAGAGACTTGAATGTTTATCTTCATCGCAAGCACCCAAATTCAACCGTATGCCCGTATCTTAAAACATCAACGATCGATCTCAAGCACCCACTCAGTAAATCATTATCAATCACCTTCAATTTCTTTAATTTGTTAATCGGAGCTAAACTTGAAGCTATCAAAAAAGCTAAAGACAGGGAGTTGTTCAAGCAAGCAATGAAGAACATCGGGCTCAAAACACCCCCATCTGGAATCGGCACCACTCTCCAAGAATGTCT...

CDS

Download CDS FASTA

417 bp · TkA08G121190|TK1151|CDS

CGAAGAGACTTGAATGTTTATCTTCATCGCAAGCACCCAAATTCAACCGTATGCCCGTATCTTAAAACATCAACGATCGATCTCAAGCACCCACTCAGTAAATCATTATCAATCACCTTCAATTTCTTTAATTTGTTAATCGGAGCTAAACTTGAAGCTATCAAAAAAGCTAAAGACAGGGAGTTGTTCAAGCAAGCAATGAAGAACATCGGGCTCAAAACACCCCCATCTGGAATCGGCACCACTCTCCAAGAATGTCT...

Protein

Download Protein FASTA

138 aa · TkA08G121190|TK1151|PROTEIN

RRDLNVYLHRKHPNSTVCPYLKTSTIDLKHPLSKSLSITFNFFNLLIGAKLEAIKKAKDRELFKQAMKNIGLKTPPSGIGTTLQECLQIANTIDTQSTQAHDIKWTHRLNCYKDIAPKCTTTDFVLRNCRHCSKKHTP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G121190`
TK1151 ID	TkA08G121190
OH-1004 ID	LXL04_036936
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 34.783 / OH-1004 4.040 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G121190

Location Chr08:31537354-31540661 (-)

Description Similar to CARB: Carbamoyl-phosphate synthase large chain, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29900`	Large subunit of the arginine-specific carbamoyl phosphate synthase (CPSase).	Analysis of ven3 and ven6 reticulate mutants reveals the importance of arginine biosynthesis in Arabidopsis leaf development.2011 · DOI: 10.1111/j.1365-313x.2010.04425.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0570700`	Large subunit of the arginine-specific carbamoyl phosphate synthase (CPSase).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036936 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006221 pyrimidine nucleotide biosynthetic process Biological Process

GO:0006526 L-arginine biosynthetic process Biological Process

GO:0006541 glutamine metabolic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0044205 'de novo' UMP biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005951 carbamoyl-phosphate synthase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004087 carbamoyl-phosphate synthase (ammonia) activity Molecular Function

GO:0004088 carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

afu:AF_1274

ana:alr3809

ath:AT1G29900

dosa:Os01g0570700

syn:sll0370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.324

Rank 1 · TkA08G121190 · TK1151

Cytoplasm0.299

Rank 2 · TkA08G121190 · TK1151

Nucleus0.189

Rank 3 · TkA08G121190 · TK1151

Extracellular0.180

Rank 4 · TkA08G121190 · TK1151

Cell membrane0.050

Rank 5 · TkA08G121190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22109Zn_ribbon_tTFIIB18-20 aa

PF02786CPSase_L_D259-93 aa

PF22109Zn_ribbon_tTFIIB120-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G121190	`PF22109`	Zn_ribbon_tTFIIB	18	20	0.046	14.3
TkA08G121190	`PF02786`	CPSase_L_D2	59	93	0.054	13.7
TkA08G121190	`PF22109`	Zn_ribbon_tTFIIB	120	133	0.046	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42601`	Arabidopsis thaliana	sp\|Q42601\|CARB_ARATH Carbamoyl phosphate synthase arginine-specific large chain, chloroplastic	83.300%	Swiss-Prot	Low
`B9EXM2`	Oryza sativa subsp. japonica	sp\|B9EXM2\|CARB_ORYSJ Carbamoyl phosphate synthase arginine-specific large chain, chloroplastic	72.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card