TkA08G118700 | RubberDandelionOmics

Gene overview

TkA08G118700

Reference: TK1151 Chr: Chr08 Coordinates: 30912233-30913688 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1350 bp · TkA08G118700|TK1151|cDNA

ATGGCAGACAAATACGGTCCCGCCTTCAATCTCCGGCTCGGAACCCGTCGTGCTTTTGTAGTCAGCAGTTGGGAAGTAGCTAAAGAATGCTTCACTGTAAACGACAAAGCCCTAATTTCCAGGCCCAAAACCGCCGCAGTGAAGCACATGGGGTATAACTACGCGGTGTTTGGCTTCGCCCCGTACACTCCATTTTGGCGCGAAATGCGGAAAATCGCCACTCTCGAGCTCCTGTCCAACCGCCGCCTCGAGATGCTCAA...

CDS

Download CDS FASTA

1350 bp · TkA08G118700|TK1151|CDS

ATGGCAGACAAATACGGTCCCGCCTTCAATCTCCGGCTCGGAACCCGTCGTGCTTTTGTAGTCAGCAGTTGGGAAGTAGCTAAAGAATGCTTCACTGTAAACGACAAAGCCCTAATTTCCAGGCCCAAAACCGCCGCAGTGAAGCACATGGGGTATAACTACGCGGTGTTTGGCTTCGCCCCGTACACTCCATTTTGGCGCGAAATGCGGAAAATCGCCACTCTCGAGCTCCTGTCCAACCGCCGCCTCGAGATGCTCAA...

Protein

Download Protein FASTA

449 aa · TkA08G118700|TK1151|PROTEIN

MADKYGPAFNLRLGTRRAFVVSSWEVAKECFTVNDKALISRPKTAAVKHMGYNYAVFGFAPYTPFWREMRKIATLELLSNRRLEMLKDVRSSEINSGIKELYGRWAENASLPVVVELNKWLEHMMLNIVVMMVAGKRYFGVGAGGHEADRCQKAISSFFRLIGIFVVSDAIPFFWWLDIHGYEKDMKETAKDLDLVLGGWLDEHRQKRKSDLDRNKDDVKDFIDVMLSLEDEDTSIKSTCLALILGGSDTTAGTLTWAIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G118700`
TK1151 ID	TkA08G118700
OH-1004 ID	LXL04_031627
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 87.763 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G118700

Location Chr08:30912233-30913688 (-)

Description Similar to CYP82C4: Xanthotoxin 5-hydroxylase CYP82C4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31940`	Can hydroxylate xanthotoxin (8-methoxypsoralen) to form 5- hydroxyxanthotoxin (5-hydroxy-8-methoxypsoralen) in vivo and in vitro.	In planta biocatalysis screen of P450s identifies 8-methoxypsoralen as a substrate for the CYP82C subfamily, yielding original chemical structures.2008 · DOI: 10.1016/j.chembiol.2008.01.008 Arabidopsis CYP82C4 expression is dependent on Fe availability and circadian rhythm, and correlates with genes involved in the early Fe deficiency response.2011 · DOI: 10.1016/j.jplph.2010.11.020
`At4g31970`	Involved in the biosynthetic pathway to 4-hydroxyindole-3- carbonyl nitrile (4-OH-ICN), a cyanogenic metabolite required for inducible pathogen defense.	In planta biocatalysis screen of P450s identifies 8-methoxypsoralen as a substrate for the CYP82C subfamily, yielding original chemical structures.2008 · DOI: 10.1016/j.chembiol.2008.01.008 A new cyanogenic metabolite in Arabidopsis required for inducible pathogen defence.2015 · DOI: 10.1038/nature14907
`At4g31950`	Cytochrome P450 82C3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031627 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009821 alkaloid biosynthetic process Biological Process

GO:0010039 response to iron ion Biological Process

GO:0010446 response to alkaline pH Biological Process

GO:0071281 cellular response to iron ion Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0106146 sideretin biosynthesis Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

KEGG gene cross-reference

ag:ALG05144

ag:UQZ09627

ath:AT4G31940

ath:AT4G31950

ath:AT4G31970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.909

Rank 1 · TkA08G118700 · TK1151

Cytoplasm0.039

Rank 2 · TkA08G118700 · TK1151

Plastid0.038

Rank 3 · TkA08G118700 · TK1151

Cell membrane0.034

Rank 4 · TkA08G118700 · TK1151

Mitochondrion0.020

Rank 5 · TkA08G118700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p4502-427 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G118700	`PF00067`	p450	2	427	2.6e-79	267.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ46`	Arabidopsis thaliana	sp\|Q9SZ46\|C82C4_ARATH Xanthotoxin 5-hydroxylase CYP82C4	63.100%	Swiss-Prot	High
`O49394`	Arabidopsis thaliana	sp\|O49394\|C82C2_ARATH Xanthotoxin 5-hydroxylase CYP82C2	61.300%	Swiss-Prot	High
`O49396`	Arabidopsis thaliana	sp\|O49396\|C82C3_ARATH Cytochrome P450 82C3	58.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card