TkA08G116000 | RubberDandelionOmics

Gene overview

TkA08G116000

Reference: TK1151 Chr: Chr08 Coordinates: 30224912-30225862 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

852 bp · TkA08G116000|TK1151|cDNA

ATGGGTTTCGTCCTCATTGCAGTTCTATCACTTTCCATATTCAGTCTTTGCTACCTCTATCTAAAATTCATCAAAACCCCATTGAAAATTCAACGCCATTTCCGTCAACAAGGCATCGGAGGACCCAACTACAACCCCATCTCCGGCAACTCCGACGAGCTCCAACGACTTATGATAGCTGAAGGCAAGTTGTCATCAAAGTCAGAATCTTTAAACCACGACCAAGTCGTTCGAAAGGTAATGCCATTCTACCACTTTTG...

CDS

Download CDS FASTA

852 bp · TkA08G116000|TK1151|CDS

ATGGGTTTCGTCCTCATTGCAGTTCTATCACTTTCCATATTCAGTCTTTGCTACCTCTATCTAAAATTCATCAAAACCCCATTGAAAATTCAACGCCATTTCCGTCAACAAGGCATCGGAGGACCCAACTACAACCCCATCTCCGGCAACTCCGACGAGCTCCAACGACTTATGATAGCTGAAGGCAAGTTGTCATCAAAGTCAGAATCTTTAAACCACGACCAAGTCGTTCGAAAGGTAATGCCATTCTACCACTTTTG...

Protein

Download Protein FASTA

283 aa · TkA08G116000|TK1151|PROTEIN

MGFVLIAVLSLSIFSLCYLYLKFIKTPLKIQRHFRQQGIGGPNYNPISGNSDELQRLMIAEGKLSSKSESLNHDQVVRKVMPFYHFWSKIYGDQFLFWFGSKPRLAITDPDMTKEILLNTSGSFPKTRVNPLVKGLFGEGIVYLEGEQWAVHRKITSQAFNMERIKELIPEIVASTKSLLDKMEAKLGEENGLELDVYKEFNNLSADVISRTAFGSNFEEGKQIFELQDQLVRIAAEAIRSVYIPGFKYLPTKKNRLSWK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G116000`
TK1151 ID	TkA08G116000
OH-1004 ID	LXL04_031604
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 56.151 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G116000

Location Chr08:30224912-30225862 (+)

Description Similar to CYP734A1: Cytochrome P450 734A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26710`	Cytochrome P450 involved in brassinosteroids (BRs) inactivation and regulation of BRs homeostasis.	BAS1 and SOB7 act redundantly to modulate Arabidopsis photomorphogenesis via unique brassinosteroid inactivation mechanisms.2005 · DOI: 10.1111/j.1365-313x.2005.02358.x Arabidopsis CYP72C1 is an atypical cytochrome P450 that inactivates brassinosteroids.2010 · DOI: 10.1007/s11103-010-9663-y

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0388000`	Cytochrome P450 involved in brassinosteroids (BRs) inactivation and regulation of BRs homeostasis.	No verified direct reference in this release
`Os02g0204700`	Cytochrome P450 involved in brassinosteroids (BRs) inactivation and regulation of BRs homeostasis.	No verified direct reference in this release
`Os06g0600400`	Cytochrome P450 involved in brassinosteroids (BRs) inactivation and regulation of BRs homeostasis.	No verified direct reference in this release
`Os07g0647200`	Cytochrome P450 probably involved in brassinosteroids (BRs) inactivation and regulation of BRs homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031604 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0010268 brassinosteroid homeostasis Biological Process

GO:0016131 brassinosteroid metabolic process Biological Process

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0008395 steroid hydroxylase activity Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT2G26710

dosa:Os01g0388000

dosa:Os02g0204700

dosa:Os06g0600400

dosa:Os07g0647200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.901

Rank 1 · TkA08G116000 · TK1151

Cytoplasm0.039

Rank 2 · TkA08G116000 · TK1151

Plastid0.038

Rank 3 · TkA08G116000 · TK1151

Cell membrane0.037

Rank 4 · TkA08G116000 · TK1151

Nucleus0.029

Rank 5 · TkA08G116000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27357MJ157923-30 aa

PF00067p45087-280 aa

PF27357MJ1579161-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G116000	`PF27357`	MJ1579	23	30	0.28	12.1
TkA08G116000	`PF00067`	p450	87	280	5e-22	79.0
TkA08G116000	`PF27357`	MJ1579	161	191	0.28	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48786`	Arabidopsis thaliana	sp\|O48786\|C734A_ARATH Cytochrome P450 734A1	44.500%	Swiss-Prot	Medium
`B9X287`	Oryza sativa subsp. japonica	sp\|B9X287\|C7346_ORYSJ Cytochrome P450 734A6	40.900%	Swiss-Prot	Medium
`Q6Z6D6`	Oryza sativa subsp. japonica	sp\|Q6Z6D6\|C7342_ORYSJ Cytochrome P450 734A2	37.300%	Swiss-Prot	Medium
`Q69XM6`	Oryza sativa subsp. japonica	sp\|Q69XM6\|C7344_ORYSJ Cytochrome P450 734A4	35.900%	Swiss-Prot	Medium
`Q8LIF2`	Oryza sativa subsp. japonica	sp\|Q8LIF2\|C7345_ORYSJ Cytochrome P450 734A5	35.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card