TkA08G115060 | RubberDandelionOmics

Gene overview

TkA08G115060

Reference: TK1151 Chr: Chr08 Coordinates: 29940825-29944040 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1829 bp · TkA08G115060|TK1151|cDNA

ATAAAACTGGTTTCGTGGGACTGTATGCCTAAAGAAGGCATATTAGGAGTTGGGAAGCAAAAGACTAACCAACAAAATCCGATTTTGCAATCCCTTCCTTCCTCTCACACATTACTGTGTGTGAGAGATAATTTAATGGAGAGCAACTCAGAATCGCCGCTCCTTGCCTCTAATCATGACACAAAGAACGCTCACTTGACCGGAGACGTCGAAGATATCCTTCCGATCAACGGAATTAGTGATTTCTTTCTCCAATTTGG...

CDS

Download CDS FASTA

1605 bp · TkA08G115060|TK1151|CDS

ATGCCTAAAGAAGGCATATTAGGAGTTGGGAAGCAAAAGACTAACCAACAAAATCCGATTTTGCAATCCCTTCCTTCCTCTCACACATTACTGTGTGTGAGAGATAATTTAATGGAGAGCAACTCAGAATCGCCGCTCCTTGCCTCTAATCATGACACAAAGAACGCTCACTTGACCGGAGACGTCGAAGATATCCTTCCGATCAACGGAATTAGTGATTTCTTTCTCCAATTTGGCGTCGAATCAAAGAAGCTTTGGTA...

Protein

Download Protein FASTA

534 aa · TkA08G115060|TK1151|PROTEIN

MPKEGILGVGKQKTNQQNPILQSLPSSHTLLCVRDNLMESNSESPLLASNHDTKNAHLTGDVEDILPINGISDFFLQFGVESKKLWYLAGPAIFTTVCQYSLGAVTQTFAGHVGTLDLAAVSIENSVIAGFALGIMVGMGSALKTLCGQAFGAGQVDMLGVYMQRSWVILFVTGLIMMFLYIFATPLLLLIGQTEDISHAAGKMALWMIPQLFAYAFNYPIAKFLQAQSKIMVMAYISAATLGLHTFFSWLLMLKLGWGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G115060`
TK1151 ID	TkA08G115060
OH-1004 ID	LXL04_031584
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.200
Protein coverage (%)	TK1151 92.322 / OH-1004 99.195 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G115060

Location Chr08:29940825-29944040 (-)

Description Similar to DTX29: Protein DETOXIFICATION 29

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12950`	Positively mediates root hair elongation.	No verified direct reference in this release
`At3g26590`	Protein DETOXIFICATION 29.	No verified direct reference in this release
`At5g38030`	Protein DETOXIFICATION 30.	No verified direct reference in this release
`At1g23300`	Protein DETOXIFICATION 32.	No verified direct reference in this release
`At1g47530`	Protein DETOXIFICATION 33.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031584 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0048767 root hair elongation Biological Process

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G12950

ath:AT1G23300

ath:AT1G47530

ath:AT3G26590

ath:AT5G38030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.387

Rank 1 · TkA08G115060 · TK1151

Lysosome / Vacuole0.353

Rank 2 · TkA08G115060 · TK1151

Endoplasmic reticulum0.114

Rank 3 · TkA08G115060 · TK1151

Golgi apparatus0.085

Rank 4 · TkA08G115060 · TK1151

Cytoplasm0.082

Rank 5 · TkA08G115060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554MatE91-251 aa

PF06305LapA_dom126-144 aa

PF24002DUF7318167-177 aa

PF06305LapA_dom169-183 aa

PF06305LapA_dom231-248 aa

PF01554MatE312-472 aa

PF06305LapA_dom380-406 aa

PF24002DUF7318393-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G115060	`PF01554`	MatE	91	251	5.1e-64	215.6
TkA08G115060	`PF06305`	LapA_dom	126	144	0.031	14.9
TkA08G115060	`PF24002`	DUF7318	167	177	4.5	8.0
TkA08G115060	`PF06305`	LapA_dom	169	183	0.031	14.9
TkA08G115060	`PF06305`	LapA_dom	231	248	0.031	14.9
TkA08G115060	`PF01554`	MatE	312	472	5.1e-64	215.6
TkA08G115060	`PF06305`	LapA_dom	380	406	0.031	14.9
TkA08G115060	`PF24002`	DUF7318	393	408	4.5	8.0
TkA08G115060	`PF24002`	DUF7318	473	525	4.5	8.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPV4`	Arabidopsis thaliana	sp\|Q9LPV4\|DTX31_ARATH Protein DETOXIFICATION 31	66.300%	Swiss-Prot	High
`Q38956`	Arabidopsis thaliana	sp\|Q38956\|DTX29_ARATH Protein DETOXIFICATION 29	64.800%	Swiss-Prot	High
`Q9LS19`	Arabidopsis thaliana	sp\|Q9LS19\|DTX30_ARATH Protein DETOXIFICATION 30	64.400%	Swiss-Prot	High
`F4I4Q3`	Arabidopsis thaliana	sp\|F4I4Q3\|DTX32_ARATH Protein DETOXIFICATION 32	63.300%	Swiss-Prot	High
`Q9SX83`	Arabidopsis thaliana	sp\|Q9SX83\|DTX33_ARATH Protein DETOXIFICATION 33	57.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card