TkA08G114860 | RubberDandelionOmics

Gene overview

TkA08G114860

Reference: TK1151 Chr: Chr08 Coordinates: 29871717-29881902 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2499 bp · TkA08G114860|TK1151|cDNA

AAAAAATCCATTTCCCCCGCCCAGCTTCACTCCTCCTCCGTGAGTTCATAAGCAACCCACCACCCGGAAAAAGCAGAAAACCAACCCCACCCACCGCTAACCACCATCCTCCGTCACGGCCGCAACTCACTGTGGCAACGTCCTCCTCACAACCGCCCATACACGTGTCGCACTCCGCCATTTTCATACAATCCCTTCTCAAATACTATTCCCCTGAAAACGAACCGTGTTTTCAGGGGAATCCGGTTCCGTCCAGAAAT...

CDS

Download CDS FASTA

1602 bp · TkA08G114860|TK1151|CDS

ATGGATGGCTTTAGCATAGATGGAGTGATGTCAGGGATACAAGGAACTAATGGCTTTGAAAAAAACACTCAATTTCCAGGCTTATGGTCATCTCCTGAAGGAAGGCAAAAAATTGATATAGGCAAACAGATCTTCTGCAACAGTGCTGTGAATATGAAAAATATAGTTGCTGTTGGGTTTGATATGGACTATACTCTGGCACAGTATAAGCCTGAAACTTTTGAGTCACTTGCTTATGATGGTACAGTTGAAAAACTTGT...

Protein

Download Protein FASTA

533 aa · TkA08G114860|TK1151|PROTEIN

MDGFSIDGVMSGIQGTNGFEKNTQFPGLWSSPEGRQKIDIGKQIFCNSAVNMKNIVAVGFDMDYTLAQYKPETFESLAYDGTVEKLVTNLGYPEELLKWSFDWTYMVRGLVLDKKRGNILKMDRHKYVKVAYHGFRLISKNEKVATYGNSFVRDAFDGPDYAHIDTLFSLAEAYLFAQLVDFKDNNPGKISEEKDYARLYNDVRSAVDMCHRDGTLKTLVAKDIKKYINEDNSIVPMLKMLKTSGRAVFLVTNSLWDYTN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G114860`
TK1151 ID	TkA08G114860
OH-1004 ID	LXL04_030476
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.900
Protein coverage (%)	TK1151 96.248 / OH-1004 79.938 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G114860`
Location	Chr08:29871717-29881902 (-)
Description	Similar to NT5C2: Cytosolic purine 5'-nucleotidase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030476` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000255 allantoin metabolic process Biological Process GO:0006204 IMP catabolic process Biological Process GO:0046037 GMP metabolic process Biological Process GO:0046040 IMP metabolic process Biological Process GO:0046054 dGMP metabolic process Biological Process GO:0046055 dGMP catabolic process Biological Process GO:0046085 adenosine metabolic process Biological Process GO:0050689 negative regulation of defense response to virus by host Biological Process GO:0070936 protein K48-linked ubiquitination Biological Process GO:0140374 antiviral innate immune response Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	bta:281951 hsa:22978 mmu:76952 pon:100172749 rno:100363253 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · TkA08G114860 · TK1151

Nucleus0.294

Rank 2 · TkA08G114860 · TK1151

Mitochondrion0.136

Rank 3 · TkA08G114860 · TK1151

Cell membrane0.132

Rank 4 · TkA08G114860 · TK1151

Golgi apparatus0.084

Rank 5 · TkA08G114860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF057615_nucleotid44-528 aa

PF00702Hydrolase57-290 aa

PF22490EndA_linker129-142 aa

PF27587PF3D7_0210200_HH216-267 aa

PF00702Hydrolase359-375 aa

PF25541TBCA_PH404-462 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G114860	`PF05761`	5_nucleotid	44	528	3e-172	574.4
TkA08G114860	`PF00702`	Hydrolase	57	290	0.073	14.2
TkA08G114860	`PF22490`	EndA_linker	129	142	0.17	12.4
TkA08G114860	`PF27587`	PF3D7_0210200_HH	216	267	0.058	14.2
TkA08G114860	`PF00702`	Hydrolase	359	375	0.073	14.2
TkA08G114860	`PF25541`	TBCA_PH	404	462	0.47	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card