RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G114230
Reference: TK1151 Chr: Chr08 Coordinates: 29705256-29710781 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3484 bp · TkA08G114230|TK1151|cDNA

TTCAAACAAAATCAGAGGGCAGAAACGTAATTCAATGAAAACTCCCGCCGCTTGAAACGCTAATAAAAATACCAACTGCTTTCCGGAACATTATACGTAACGTCCAGAGTCCACAAGGGCCAAACTCCACAATCTCACCGGCGACGATTGTGTTTTTCCACCGACGGCAACCTGGAACGCCGTGAAAAACCTTTCATTATCTCTCTGATTCTCTCCTCCACCTCTTAACGGAGAACTTAACGGCATGTCTGACGCAGACG...

CDS

Download CDS FASTA

1692 bp · TkA08G114230|TK1151|CDS

ATGTCTGACGCAGACGAACAATCTGTTCTTCATCACCGTTGGGAAGGAACCTCTAGCTACTATGAAAGCACTGAACAAAACTCCGACTTTGAAATCTCCGGAGAAGAAAAAACAAGTAAAATTAGAACATTAAAAAAGGCAGCAAAGAATGCATCAAGTAAAATTCGTCACTCTCTTAATAAAAAAAGTAACAAGAAAAACAATACCCAACTTTCCATTCCTATCAAAGATGTCCGTGATCCCACTGAAATAAACTCAGT...

Protein

Download Protein FASTA

563 aa · TkA08G114230|TK1151|PROTEIN

MSDADEQSVLHHRWEGTSSYYESTEQNSDFEISGEEKTSKIRTLKKAAKNASSKIRHSLNKKSNKKNNTQLSIPIKDVRDPTEINSVNSFRQILVADELLPEKFDDYFTILRFLKARNFDTEKSKHMWVNMLQWRKAFNIDNIFEDFEFNELNEVLEHYPQGYHGVDKQGRPIYIELLGKSDPDKVMLVTTLDRYVKYHVQGFERTTAIRFPACSLAAHTRIDSGTTILDVQGVGLKNLSRSALDVIRKLQQIDNDYYPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G114230
TK1151 IDTkA08G114230
OH-1004 IDLXL04_031557
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G114230
LocationChr08:29705256-29710781 (+)
DescriptionSimilar to SFH6: Phosphatidylinositol/phosphatidylcholine transfer protein SFH6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g39170 Required for transport of secretory proteins from the Golgi complex. No verified direct reference in this release
At2g21520 Required for transport of secretory proteins from the Golgi complex. No verified direct reference in this release
At1g75370 Required for transport of secretory proteins from the Golgi complex. No verified direct reference in this release
At1g19650 Required for transport of secretory proteins from the Golgi complex. No verified direct reference in this release
At2g21540 Required for transport of secretory proteins from the Golgi complex (By similarity).
Identification of two phosphatidylinositol/phosphatidylcholine transfer protein genes that are predominately transcribed in the flowers of Arabidopsis thaliana.2007 · DOI: 10.1016/j.jplph.2006.03.014

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031557 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006892 post-Golgi vesicle-mediated transport Biological Process
GO:0009908 flower development Biological Process
GO:0015031 protein transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0008526 phosphatidylinositol transfer activity Molecular Function
KEGG gene cross-reference
ath:AT1G19650
ath:AT1G75370
ath:AT2G21520
ath:AT2G21540
ath:AT4G39170
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.269
Rank 1 · TkA08G114230 · TK1151
Cytoplasm0.229
Rank 2 · TkA08G114230 · TK1151
Golgi apparatus0.192
Rank 3 · TkA08G114230 · TK1151
Cell membrane0.180
Rank 4 · TkA08G114230 · TK1151
Nucleus0.126
Rank 5 · TkA08G114230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04504GeBP-like_DBD15-65 aa
PF08998Epsilon_antitox37-70 aa
PF28528UBA_Pinta85-137 aa
PF19583ODP98-133 aa
PF03765CRAL_TRIO_N105-130 aa
PF08998Epsilon_antitox109-157 aa
PF00650CRAL_TRIO157-319 aa
PF13716CRAL_TRIO_2236-318 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G114230PF04504GeBP-like_DBD15651.510.3
TkA08G114230PF08998Epsilon_antitox37700.006317.6
TkA08G114230PF28528UBA_Pinta851370.0002122.2
TkA08G114230PF19583ODP981330.1712.5
TkA08G114230PF03765CRAL_TRIO_N1051302.4e-0525.1
TkA08G114230PF08998Epsilon_antitox1091570.006317.6
TkA08G114230PF00650CRAL_TRIO1573194.6e-32111.7
TkA08G114230PF13716CRAL_TRIO_22363180.0002921.9
TkA08G114230PF04504GeBP-like_DBD2923041.510.3
TkA08G114230PF19583ODP3904460.1712.5
TkA08G114230PF13716CRAL_TRIO_24314660.0002921.9
TkA08G114230PF04504GeBP-like_DBD4804991.510.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4JVA6Arabidopsis thalianasp|F4JVA6|SFH6_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH647.400%Swiss-ProtMedium
F4IHJ0Arabidopsis thalianasp|F4IHJ0|SFH8_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH847.400%Swiss-ProtMedium
Q8GXC6Arabidopsis thalianasp|Q8GXC6|SFH5_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH547.500%Swiss-ProtMedium
F4HP88Arabidopsis thalianasp|F4HP88|SFH4_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH447.500%Swiss-ProtMedium
Q93ZE9Arabidopsis thalianasp|Q93ZE9|SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH343.500%Swiss-ProtMedium

JBrowse

View in Genome Browser