TkA08G113040 | RubberDandelionOmics

Gene overview

TkA08G113040

Reference: TK1151 Chr: Chr08 Coordinates: 29452288-29452978 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · TkA08G113040|TK1151|cDNA

ATGTCTCCTGTTCTCTGTGAAATCCTCCGTTCCGGGTTTATGATAAATTCCTCCCTCGTCCGCCGTACCCATCTTGTTCAATCTTTCTCCGTCGTCTTCCTTTACTGGTTCGGAAATTCATCTGGGTCGACGCAGATCCACCACTCTGGATCGGACGACGGCGCCATGGACCAGCGGAAGAGGAAGAGGATGGAATCAAACCGCGAATCGGCTCGCAGATCGAGGATGAGGAAGCAAAAGCATATGGATGATCTGATGAC...

CDS

Download CDS FASTA

564 bp · TkA08G113040|TK1151|CDS

ATGTCTCCTGTTCTCTGTGAAATCCTCCGTTCCGGGTTTATGATAAATTCCTCCCTCGTCCGCCGTACCCATCTTGTTCAATCTTTCTCCGTCGTCTTCCTTTACTGGTTCGGAAATTCATCTGGGTCGACGCAGATCCACCACTCTGGATCGGACGACGGCGCCATGGACCAGCGGAAGAGGAAGAGGATGGAATCAAACCGCGAATCGGCTCGCAGATCGAGGATGAGGAAGCAAAAGCATATGGATGATCTGATGAC...

Protein

Download Protein FASTA

187 aa · TkA08G113040|TK1151|PROTEIN

MSPVLCEILRSGFMINSSLVRRTHLVQSFSVVFLYWFGNSSGSTQIHHSGSDDGAMDQRKRKRMESNRESARRSRMRKQKHMDDLMTQANKLKNNNAQILTTIDVTTQRSVQIEAENSVLRAQVSELSQRLDSLNEMINYINTNTNCTTAQCTTTGVNGSFEFDFADNPWNMMYLNQPTIMADMVGY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G113040`
TK1151 ID	TkA08G113040
OH-1004 ID	LXL04_031549
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 80.214 / OH-1004 96.774 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G113040

Location Chr08:29452288-29452978 (-)

Description Similar to BZIP44: bZIP transcription factor 44

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75390`	Transcription factor that binds to the DNA G-box motif 5'- CACGTG-3' of MAN7 promoter.	Arabidopsis thaliana bZIP44: a transcription factor affecting seed germination and expression of the mannanase-encoding gene AtMAN7.2013 · DOI: 10.1111/tpj.12162
`At2g18160`	Transcription factor that binds to specific DNA sequences in target gene promoters.	No verified direct reference in this release
`At4g34590`	Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters.	A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.2004 · DOI: 10.1093/pcp/pch036 The sucrose regulated transcription factor bZIP11 affects amino acid metabolism by regulating the expression of ASPARAGINE SYNTHETASE1 and PROLINE DEHYDROGENASE2.2008 · DOI: 10.1111/j.1365-313x.2007.03385.x The sucrose-regulated Arabidopsis transcription factor bZIP11 reprograms metabolism and regulates trehalose metabolism.2011 · DOI: 10.1111/j.1469-8137.2011.03735.x The Arabidopsis transcription factor bZIP11 activates auxin-mediated transcription by recruiting the histone acetylation machinery.2014 · DOI: 10.1038/ncomms4883
`At3g62420`	May bind specific sequences in target-gene promoters and activate transcription.	A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.2004 · DOI: 10.1093/pcp/pch036 Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.2006 · DOI: 10.1038/sj.emboj.7601206 A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968 Heterodimers of the Arabidopsis transcription factors bZIP1 and bZIP53 reprogram amino acid metabolism during low energy stress.2011 · DOI: 10.1105/tpc.110.075390 A novel method to identify the DNA motifs recognized by a defined transcription factor.2014 · DOI: 10.1007/s11103-014-0234-5
`At5g38800`	Probable transcription factor involved in somatic embryogenesis.	Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.2016 · DOI: 10.1016/j.jplph.2016.02.012

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031549 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006971 hypotonic response Biological Process

GO:0009267 cellular response to starvation Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009845 seed germination Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0080149 sucrose induced translational repression Biological Process

GO:2000693 positive regulation of seed maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G75390

ath:AT2G18160

ath:AT3G62420

ath:AT4G34590

zma:542394

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkA08G113040 · TK1151

Cytoplasm0.114

Rank 2 · TkA08G113040 · TK1151

Cell membrane0.024

Rank 3 · TkA08G113040 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA08G113040 · TK1151

Plastid0.011

Rank 5 · TkA08G113040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05308Mito_fiss_reg51-130 aa

PF03131bZIP_Maf53-117 aa

PF07716bZIP_257-103 aa

PF28422CCDC8958-154 aa

PF15275PEHE58-133 aa

PF16124RecQ_Zn_bind58-86 aa

PF00170bZIP_159-107 aa

PF25762HAUS160-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G113040	`PF05308`	Mito_fiss_reg	51	130	0.013	16.4
TkA08G113040	`PF03131`	bZIP_Maf	53	117	2.5	9.4
TkA08G113040	`PF07716`	bZIP_2	57	103	3.8e-09	37.2
TkA08G113040	`PF28422`	CCDC89	58	154	0.0082	16.2
TkA08G113040	`PF15275`	PEHE	58	133	0.099	13.9
TkA08G113040	`PF16124`	RecQ_Zn_bind	58	86	0.37	12.3
TkA08G113040	`PF00170`	bZIP_1	59	107	5.4e-11	43.1
TkA08G113040	`PF25762`	HAUS1	60	142	0.5	10.8
TkA08G113040	`PF13874`	Nup54	60	142	0.69	10.7
TkA08G113040	`PF06428`	Sec2p	61	138	0.18	12.7
TkA08G113040	`PF28121`	VPA1267	62	99	0.29	12.0
TkA08G113040	`PF12795`	MscS_porin	63	151	0.066	13.5
TkA08G113040	`PF29997`	SPC25_N	63	137	0.66	11.0
TkA08G113040	`PF03744`	BioW	64	150	0.057	13.7
TkA08G113040	`PF04977`	DivIC	75	102	8.1	7.0
TkA08G113040	`PF04899`	MbeD_MobD	78	93	0.11	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0Z2L5`	Arabidopsis thaliana	sp\|C0Z2L5\|BZP44_ARATH bZIP transcription factor 44	49.000%	Swiss-Prot	Medium
`Q9SI15`	Arabidopsis thaliana	sp\|Q9SI15\|BZIP2_ARATH bZIP transcription factor 2	61.700%	Swiss-Prot	Low
`O65683`	Arabidopsis thaliana	sp\|O65683\|BZP11_ARATH bZIP transcription factor 11	45.900%	Swiss-Prot	Medium
`Q9LZP8`	Arabidopsis thaliana	sp\|Q9LZP8\|BZP53_ARATH bZIP transcription factor 53	48.100%	Swiss-Prot	Medium
`Q9FMC2`	Arabidopsis thaliana	sp\|Q9FMC2\|BZP43_ARATH Basic leucine zipper 43	35.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card