TkA08G112990 | RubberDandelionOmics

Gene overview

TkA08G112990

Reference: TK1151 Chr: Chr08 Coordinates: 29433045-29436614 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2205 bp · TkA08G112990|TK1151|cDNA

CTGATATGTCACGTGCCAGCCAAATACTACCACGTGACTCCCGATGTGTTATAAATAGAGAGCCTGCATCTTCTATCTGGACATAACTCGCTCACTCCCGCAAACACTCCCTCTCTTTCTCTTTTTTCTTTCACTCTCTCACACAAACACTCTCACTACGTGTAATGATTCTTTAAAGAAATTCACAATTAAAAAGAAAAAAAAAGAATTCTTGATTTCCAACCTTCTATATATAGCAACAATCAACCCGTGCAAACCGA...

CDS

Download CDS FASTA

1578 bp · TkA08G112990|TK1151|CDS

ATGGCACCAAATCTGCTACTACTCACCGCCATATGCCGTTTGATAGCGATCGTCGGACTAACACTCCACCCTACCGACCTCCTCCTCGCCGGAACAGAAACTCAATTAAGCTTCAACCGAACAGACATCCAGTCAGCTTCACTCGATTTCGGAAGAATGACGATCACCGAACCGACAGCGGTTCTCCATCCGTCTTCCACCGGCGACGTCGCTAAGATCATAAAGCTAGCTTACGATTCCGCTGACGGATTCGTGGTATC...

Protein

Download Protein FASTA

525 aa · TkA08G112990|TK1151|PROTEIN

MAPNLLLLTAICRLIAIVGLTLHPTDLLLAGTETQLSFNRTDIQSASLDFGRMTITEPTAVLHPSSTGDVAKIIKLAYDSADGFVVSARGHGHSINGQSQAANGVVVQMSGSRGKPVAPEVSEKLMYVDVWGGELWIDVLKSTLPYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHEVDVVTGKGDVVTCAEDKNPELFHAVMGGLGQFGIITRARIALEPSPRRVRWIRVLYSNFSEFTHDQEYLISLHG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G112990`
TK1151 ID	TkA08G112990
OH-1004 ID	LXL04_031546
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G112990

Location Chr08:29433045-29436614 (+)

Description Similar to CKX5: Cytokinin dehydrogenase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75450`	Catalyzes the oxidation of cytokinins, a family of N(6)-substituted adenine derivatives that are plant hormones, where the substituent is an isopentenyl group (By similarity).	No verified direct reference in this release
`At2g41510`	May catalyze oxidative degradation of cytokinins.	Vacuolar and cytosolic cytokinin dehydrogenases of Arabidopsis thaliana: heterologous expression, purification and properties.2010 · DOI: 10.1016/j.phytochem.2010.08.013 Jasmonate inhibits adventitious root initiation through repression of CKX1 and activation of RAP2.6L transcription factor in Arabidopsis.2021 · DOI: 10.1093/jxb/erab358 Cytokinin regulates female gametophyte development by cell cycle modulation in Arabidopsis thaliana.2022 · DOI: 10.1016/j.plantsci.2022.111419
`At3g63440`	Catalyzes the oxidation of cytokinins, a family of N(6)-substituted adenine derivatives that are plant hormones, where the substituent is an isopentenyl group.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0775400`	Catalyzes the oxidation of cytokinins, a family of N(6)-substituted adenine derivatives that are plant hormones, where the substituent is an isopentenyl group.	No verified direct reference in this release
`Os05g0374200`	Catalyzes the oxidation of cytokinins, a family of N(6)-substituted adenine derivatives that are plant hormones, where the substituent is an isopentenyl group (Probable).	Strigolactone promotes cytokinin degradation through transcriptional activation of CYTOKININ OXIDASE/DEHYDROGENASE 9 in rice.2019 · DOI: 10.1073/pnas.1810980116

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031546 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009690 cytokinin metabolic process Biological Process

GO:0009823 cytokinin catabolic process Biological Process

GO:0010103 stomatal complex morphogenesis Biological Process

GO:0048507 meristem development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0019139 cytokinin dehydrogenase activity Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ath:AT1G75450

ath:AT2G41510

ath:AT3G63440

dosa:Os01g0775400

dosa:Os05g0374200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.296

Rank 1 · TkA08G112990 · TK1151

Lysosome / Vacuole0.211

Rank 2 · TkA08G112990 · TK1151

Cytoplasm0.207

Rank 3 · TkA08G112990 · TK1151

Golgi apparatus0.114

Rank 4 · TkA08G112990 · TK1151

Extracellular0.103

Rank 5 · TkA08G112990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01565FAD_binding_458-199 aa

PF09265Cytokin-bind232-514 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G112990	`PF01565`	FAD_binding_4	58	199	1.1e-19	71.3
TkA08G112990	`PF09265`	Cytokin-bind	232	514	4.8e-124	414.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67YU0`	Arabidopsis thaliana	sp\|Q67YU0\|CKX5_ARATH Cytokinin dehydrogenase 5	69.100%	Swiss-Prot	High
`O22213`	Arabidopsis thaliana	sp\|O22213\|CKX1_ARATH Cytokinin dehydrogenase 1	53.700%	Swiss-Prot	High
`Q9LY71`	Arabidopsis thaliana	sp\|Q9LY71\|CKX6_ARATH Cytokinin dehydrogenase 6	53.500%	Swiss-Prot	High
`Q5ZAY9`	Oryza sativa subsp. japonica	sp\|Q5ZAY9\|CKX5_ORYSJ Cytokinin dehydrogenase 5	63.900%	Swiss-Prot	High
`Q75K78`	Oryza sativa subsp. japonica	sp\|Q75K78\|CKX9_ORYSJ Cytokinin dehydrogenase 9	51.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card